Identifiers and Description

Gene Model Identifier

TTHERM_00666220

Standard Name

ALG11 (Predicted alpha-1,2-mannosyltransferase Alg11)

Aliases

PreTt23875 | 99.m00116

Description

Alpha-1,2-mannosyltransferase, catalyzes addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol in termediate during asparagine-linked glycosylation in the ER

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00534 ) glycosyl transferase, group 1 family
  • ( PF08041 ) PetM family of cytochrome b6f

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.6%

TetraMine Data

TTHERM_00666220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16538.19.997093137033517e-262glycosyl transferase, group 1
family protein (484 aa)
DictyBaseDDB_G02921189.997329401607134e-86alg11 on chromosome: 6 positio
n 1220852 to 1222575
WormBaseWBGene000151625.000996804856152e-78Uncharacterized glycosyltransf
erase B0361.8 status:Confirm
ed UniProt:P53993 protein_
id:CCD61823.1
SGDYNL048W1.0002012508493003e-67ALG11 Alpha-1,2-mannosyltransf
erase, catalyzes sequential ad
dition of the two terminal alp
ha 1,2-mannose residues to the
Man5GlcNAc2-PP-dolichol inter
mediate during asparagine-link
ed glycosylation in the ER
Stentor CoeruleusSteCoe_155986.054601895401186e-39
OxytrichaContig20481.0.0.g52.0008113830639685e-30Glycosyl transferases group 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00666220(coding)
ATGGCCTCATTTATTTTTAAAATTTTGATTATCAGCTTTTTATATGTATTTCTTCCTCTA
TTGGCTATTTATACTTTACTAAAGCTTGTAGTCAGGTTAAAAAAGTTTATTAGAAATAAA
GGGAATTCAAAATTGAAAATAGCATTTTTCCATCCTTATTGCAATTCAGCAGGAGGCGGA
GAAAAAGTTCTATGGTGTTTGGTTTATTCACTTTTAAATTGTGTAGCATATAGGGAAAAT
TTTGAACTGGTTATATACACAGGAGATTAAGTTAGTGGAGAGGATATTTTAAAGAAAGCA
ACTGACAGGTTTAATATTAATGTTCTTGAGCTTAAAGATAAGATTTAATTTATCAGGGTT
TCAGGTAGAAAACTGCTCGAACCTTTTAGAGTAGCTACTATGATCCTTTAAGCTATTGGA
ACAATGATTTATACTTTTAAATGTCTGCTTAAATACCAACCTGATATTTTCTTTGATTCC
ACAGGTTTTGCCTTTTCCTATATTGTTGTTAAAAAGTTTTTAGGATGTAAGGTTGTCTCA
TACACTCACTATCCATTTATAAGCTCAGATATGATTTAAAAAGTCATTAGAAATGAATAA
TCTTTTAATAATAGAGGCTTTATTGCATAATCTGGACTCTTTTCTAATATTAAGTTTTTC
TACTATTTGATATTAACAAAAATGTACAAATTCATGGGAAATTATGTAGATATGACTTTC
ACTAATTCAACATGGACAGATGATCATATTAGAAGTTTGTGGGCTCCTTGTCGTTAAGTC
GAAACTATTACAGAATCAGTGAAATTATATCCACCATGTAATGTTACTTCTTTACTTGAG
TTAGAAAAGAATTAAGAAAATTCAACTGTACAAATTATGTCTTTCGCCTAATTCCGCCCT
GAAAAAGACCACATGATGCAAATCAGAGTTTTTGAAAGAGTGCTTTCGAGATTAACAGAT
GAAGAAAAGCATAAACTATAATTCAGAGTAGTTGGATCTGTGAGAAACGATGATGACGAG
TAGTTGTTAAGCAATCTCAAAAAAGAAGTTGAATAAAGACATCTTAGTGATAAAATTTAA
TTTATCAAAAATCCATCTTTCAAAGATATTTTGAAAATATTTGAGCAAAGTGATATTGGA
TTGCACACTATGAAAGATGAGCACTTTGGAATTGCAGTCGTCGAAATGATGGCTGGAGGA
TTAATTACGATAGCACATAAGAGCGCTGGCCCTTTGAAAGATATTATTTAAAATGAAAAT
TTCGGGTTTTTGTGTGAAAATGAAGATGAATATGTTGAAGCAACTTTAAAAGCTGTTTAA
ATGCCAAAAGAAGTCAAATAGGAGTTAGTAAGTAATTCTAGACAAAAAGCTTAAGAATTT
AGTGAAGATATGTTTTACATTAAAAGTGCTGCTCATTTCGAGAACTTTTTAGAATATTTT
AATTTAGTTAAAAAGGTTTGA


>TTHERM_00666220(protein)
MASFIFKILIISFLYVFLPLLAIYTLLKLVVRLKKFIRNKGNSKLKIAFFHPYCNSAGGG
EKVLWCLVYSLLNCVAYRENFELVIYTGDQVSGEDILKKATDRFNINVLELKDKIQFIRV
SGRKLLEPFRVATMILQAIGTMIYTFKCLLKYQPDIFFDSTGFAFSYIVVKKFLGCKVVS
YTHYPFISSDMIQKVIRNEQSFNNRGFIAQSGLFSNIKFFYYLILTKMYKFMGNYVDMTF
TNSTWTDDHIRSLWAPCRQVETITESVKLYPPCNVTSLLELEKNQENSTVQIMSFAQFRP
EKDHMMQIRVFERVLSRLTDEEKHKLQFRVVGSVRNDDDEQLLSNLKKEVEQRHLSDKIQ
FIKNPSFKDILKIFEQSDIGLHTMKDEHFGIAVVEMMAGGLITIAHKSAGPLKDIIQNEN
FGFLCENEDEYVEATLKAVQMPKEVKQELVSNSRQKAQEFSEDMFYIKSAAHFENFLEYF
NLVKKV


>TTHERM_00666220(gene)
ATGGCCTCATTTATTTTTAAAATTTTGATTATCAGCTTTTTATATGTATTTCTTCCTCTA
TTGGCTATTTATACTTTACTAAAGCTTGTAGTCAGGTTAAAAAAGTTTATTAGAAATAAA
GGGAATTCAAAATTGAAAATAGCATTTTTCCATCCTTATTGGTAATTAACACAATTCAAA
TCAAAGATTTTTTGTTTTTACAATGATTTTTCCTCAAACAGCAATTCAGCAGGAGGCGGA
GAAAAAGTTCTATGGTGTTTGGTTTATTCACTTTTAAATTGTGTAGCATATAGGGAAAAT
TTTGAACTGGTTATATACACAGGTATGTTAATATAGTCAAATCTATTTTATTCAATTATT
AATTGATTTAAAGGAGATTAAGTTAGTGGAGAGGATATTTTAAAGAAAGCAACTGACAGG
TTTAATATTAATGTTCTTGAGCTTAAAGATAAGATTTAATTTATCAGGGTTTCAGGTAGA
AAACTGCTCGAACCTTTTAGAGTAGCTACTATGATCCTTTAAGCTATTGGAACAATGATT
TATACTTTTAAATGTCTGCTTAAATACCAACCTGATATTTTCTTTGATTCCACAGGTTTT
GCCTTTTCCTATATTGTTGTTAAAAAGTTTTTAGGATGTAAGGTTGTCTCATACACTCAC
TATCCATTTATAAGCTCAGATATGATTTAAAAAGTCATTAGAAATGAATAATCTTTTAAT
AATAGAGGCTTTATTGCATAATCTGGACTCTTTTCTAATATTAAGTTTTTCTACTATTTG
ATATTAACAAAAATGTACAAATTCATGGGAAATTATGTAGATATGACTTTCACTAATTCA
ACATGGACAGATGATCATATTAGAAGTTTGTGGGCTCCTTGTCGTTAAGTCGAAACTATT
ACAGAATCAGTGAAATTGTAAATTAAATTGAAACAAAATCTATTTTTATGAAATAATAGA
AATTATGTTTATTAAAAGATATCCACCATGTAATGTTACTTCTTTACTTGAGTTAGAAAA
GAATTAAGAAAATTCAACTGTACAAATTATGTCTTTCGCCTAATTCCGCCCTGAAAAAGA
CCACATGATGCAAATCAGAGTTTTTGAAAGAGTGCTTTCGAGATTAACAGATGAAGAAAA
GCATAAACTATAATTCGTAATACCTTAAATAAAAATAAATATTCTAATTACTTGTTTTAA
CATAAAAAATAGAGAGTAGTTGGATCTGTGAGAAACGATGATGACGAGTAGTTGTTAAGC
AATCTCAAAAAAGAAGTTGAATAAAGACATCTTAGTGATAAAATTTAATTTATCAAAAAT
CCATCTTTCAAAGATATTTTGAAAATATTTGAGCAAAGTGATATTGGATTGCACACTATG
AAAGATGAGCACTTTGGAATTGCAGTCGTCGAAATGATGGTAGATTTTTATTTGAAATAT
AGAGAAAATTTTAATAGAGAATTTTAATGTAAATAAGGCTGGAGGATTAATTACGATAGC
ACATAAGAGCGCTGGCCCTTTGAAAGATATTATTTAAAATGAAAATTTCGGGTTTTTGTG
TGAAAATGAAGATGAATATGTTGAAGCAACTTTAAAAGCTGTTTAAATGTAAAATAATTT
TTATTTAATTGTTTTAATAATAATTTTTTTTAATAGGCCAAAAGAAGTCAAATAGGAGTT
AGTAAGTAATTCTAGACAAAAAGCTTAAGAATTTAGTGAAGATATGTTTTACATTAAAAG
TGCTGCTCATTTCGAGAACTTTTTAGAATATTTTAATTTAGTTAAAAAGGTTTGA