Identifiers and Description

Gene Model Identifier

TTHERM_00954200

Standard Name

ALG1 (predicted beta-1,4-mannosyltransferase Alg1)

Aliases

PreTt04996 | 176.m00069

Description

Mannosyltransferase, involved in asparagine-linked glycosylation in the endoplasmic reticulum (ER)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00534 ) glycosyl transferase, group 1 family
  • ( TIGR01609 ) Plasmodium falciparum uncharacterized protein TIGR01609

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00954200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13503.19.997093137033517e-262chitobiosyldiphosphodolichol b
eta-mannosyltransferase (1987
aa)
DictyBaseDDB_G02860111.99970314379378e-94alg1 on chromosome: 4 position
3960039 to 3961587
WormBaseWBGene000208201.0004883026569571e-88status:Confirmed UniProt:Q22
797 protein_id:CCD63217.1
OxytrichaContig11090.0.g281.0003926095686843e-81Glycosyl transferases group 1
SGDYBR110W6.002203762674495e-72ALG1 Mannosyltransferase, invo
lved in asparagine-linked glyc
osylation in the endoplasmic r
eticulum (ER); essential for v
iability, mutation is function
ally complemented by human ort
holog

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00954200(coding)
ATGAGCTAAAAGCAAGTAGCATCTGTCATCGTTTTTGGCGATATTGGTAGATCACCAAGA
ATGAAAAATCATTCAACATAATTGGCTTAAGCTGGTTATGAAGTTTATTTTGTAGGTTAA
TTAGAAAATTAGGTGCATAAAGTAATTAGAGACAATCCAAATATAAAAATTATTGACATA
TCTTCAAATCTCGTCAACAAACTTAAAAAATTACCAAGATTCTTATATTTGCTTTATGCT
GCTCTTAGAATTATAATTTAAATATTTTAGCTCTTTTACATCTATCTTTTCAAAATGCCT
AAACCTGAATTTGTTATAATACAAAATCCTCCTTCAATTCCTGTACTTTCTTCGTTGGCC
ATAATTTGTTTCATGAGAAGAATCAAAATGATTGTAGATTTTCATAATTATGGATATACT
ATTTTAGCATTAGGTTTGAAACAAAAAATTATTTTAAAACTGGCTACATTCTATGAAAAA
TATTTTGCTAAAAAATGTGATTTCGCCTTTTGCGTTTCTGATGCTATGAAAGCCGATTTG
AAAAAAAATTGGAATATAGAAGCAACTACCCTTTATGATAAAGCTAATACTGAGTTATTT
GGGCCCATCTCTCTTCAGGAATCCCATAAGCTATTCCTTGAACTTGGTTTAAGCATTAAT
TAAAAAGAAACACTTTTCACTGAAGAAGTGAATGGAAAAATAATAAAAAAGTAGTAAAGA
CCTCTACTTTTAGTTAGCAGTACTTCTTGGACTAAAGATGAAGATTTCAGTATTTTATTA
GATGCTATGCAATCATATGAAACTGAAAAAGAAGTAAATAAGCAAAACTCTTTGTATCCA
AAGCTACACCTTCTTATCACAGGAAAAGGACCAGAAAAAGAAAGATACGAACAAATAATT
GAAGAAAGGAAGAAAAGTTGGAAAAATATATAAATATAAACAGTTTGGCTAAAAGCAGAA
GACTACCCTAAATTGTTGGCTAGTGCAGATGTAGGAATATGTCTTCACTACTCTTCATCT
GGTCTTGATCTACCGATGAAAGTAGTAGATATGCTTGGATCTAACTTACCTGTTTTTGCA
ATAAATTACTAGTGTATTAATGAGCTAGTAGTTAATCAAAAAAATGGTTTTATTTTTGAC
AACACTTAAGGGTTACTCAACTTGTTTTTGAAATACTTCAAAATGCATCCAGAAAATGAA
TTAACATTTGAAAACTTGAGAAAAAGTGCTTCTAAATTTAGAGAGAGTACTTGGGAAAAA
GAATGGCAATAAAAAGTGTTACCTATTTTAAATTAGATTAAACAATCTAAAATTAATAAA
AAAAAATAATGA


>TTHERM_00954200(protein)
MSQKQVASVIVFGDIGRSPRMKNHSTQLAQAGYEVYFVGQLENQVHKVIRDNPNIKIIDI
SSNLVNKLKKLPRFLYLLYAALRIIIQIFQLFYIYLFKMPKPEFVIIQNPPSIPVLSSLA
IICFMRRIKMIVDFHNYGYTILALGLKQKIILKLATFYEKYFAKKCDFAFCVSDAMKADL
KKNWNIEATTLYDKANTELFGPISLQESHKLFLELGLSINQKETLFTEEVNGKIIKKQQR
PLLLVSSTSWTKDEDFSILLDAMQSYETEKEVNKQNSLYPKLHLLITGKGPEKERYEQII
EERKKSWKNIQIQTVWLKAEDYPKLLASADVGICLHYSSSGLDLPMKVVDMLGSNLPVFA
INYQCINELVVNQKNGFIFDNTQGLLNLFLKYFKMHPENELTFENLRKSASKFRESTWEK
EWQQKVLPILNQIKQSKINKKKQ


>TTHERM_00954200(gene)
ATGAGCTAAAAGCAAGTAGCATCTGTCATCGTTTTTGGCGATATTGGTAGATCACCAAGA
ATGAAAAATCATTCAACATAATTGGCTTAAGCTGGTTATGAAGTTTATTTTGTAGGTTAA
TTAGGTAAATTAAAAAGATAGATAAGCATTTATAATTTAAAATTAATTTGTAGAAAATTA
GGTGCATAAAGTAATTAGAGACAATCCAAATATAAAAATTATTGACATATCTTCAAATCT
CGTCAACAAACTTAAAAAATTACCAAGATTCTTATATTTGCTTTATGCTGCTCTTAGAAT
TATAATTTAAATATTTTAGCTCTTTTACATCTATCTTTTCAAAATGCCTAAACCTGAATT
TGTTATAATACAAGTAAATAATTAGCTTTTAAACTAAAATAATTTATAAGAATGCATACA
GTAAATGTAAATTGATAAAACATACCATCAAAAATTCATTCATTCGTTAAAAAATTATAA
TTTAAGTTTTTTAAAGAGATATTTTAGATGGTTTCTTTTATTTTTTAATAAGAATGAATT
AAACAAAATAAATAGAGTTTTTTTGATCTAATTTTATAATGCTAAAATAAATTGAATGAA
TGTAAATTGATTGTTAATATTTAAATAATAGAATCCTCCTTCAATTCCTGTACTTTCTTC
GTTGGCCATAATTTGTTTCATGAGAAGAATCAAAATGATTGTAGATTTTCATAATTATGG
ATATACTATTTTAGCATTAGGTTTGAAACAAAAAATTATTTTAAAACTGGCTACATTCTA
TGAAAAATATTTTGCTAAAAAATGTGATTTCGCCTTTTGCGTTTCTGATGCTATGAAAGC
CGATTTGAAAAAAAATTGGAATATAGAAGCAACTACCCTTTATGATAAAGCTAATACTGA
GTTATTTGGGCCCATCTCTCTTCAGGAATCCCATAAGCTATTCCTTGAACTTGGTTTAAG
CATTAATTAAAAAGAAACACTTTTCACTGAAGAAGTGAATGGAAAAATAATAAAAAAGTA
GTAAAGACCTCTACTTTTAGTTAGCAGTACTTCTTGGACTAAAGATGAAGTATTTATTTA
TTTCAATTTTATATTAAAAAATAAAATTGTATTATTATTATTATAAAAAATTCAAGGATT
TCAGTATTTTATTAGATGCTATGCAATCATATGAAACTGAAAAAGAAGTAAATAAGCAAA
ACTCTTTGTATCCAAAGCTACACCTTCTTATCACAGGTAAACAAATATTTTCAAATTTAA
TTTAAATAAATAATTTTTTTAAAATAACTTTTATTATATCAAATAACATTTAAAATATAT
CTAATTTATTTCATCTAAATCATCAAATAATTTTATTTATTATTGATTGATTTATTTATT
TTTTTAATATTTTAGGAAAAGGACCAGAAAAAGAAAGATACGAACAAATAATTGAAGAAA
GGAAGAAAAGTTGGAAAAATATATAAATATAAACAGTTTGGCTAAAAGCAGAAGACTACC
CTAAATTGTTGGCTAGTGCAGATGTAGGAATATGTCTTCACTACTCTTCATCTGGTCTTG
ATCTACCGATGAAAGTAGTAGATATGCTTGGATCTAACTTACCTGTTTTTGCAATAAATT
ACTAGTGGTAATTAAATATTTTAAAAGTCTTGAAAAAGAAAGATAACTAACTAACTATAT
TATTAAATCAAAAAGTATTAATGAGCTAGTAGTTAATCAAAAAAATGGTTTTATTTTTGA
CAACACTTAAGGGTTACTCAACTTGTTTTTGGTAAATTTATTAATAAACAAACAAACAAA
CAAACAAACAAACAAACAAACAAACAAACAACATATATACATATTGATTTCTCATAAAAT
CTCATTCGTTTTTTTGTTGATTTTTAATACTAGAAATACTTCAAAATGCATCCAGAAAAT
GAATTAACATTTGAAAACTTGAGAAAAAGTGCTTCTAAATTTAGAGAGAGTACTTGGGAA
AAAGGTATAAATAAATTAAAAAAAATAATTAATTAATTTTACAATAATTTAAATTCTTTT
TATAAAACATTAAAGAATGGCAATAAAAAGTGTTACCTATTTTAAATTAGATTAAACAAT
CTAAAATTAATAAAAAAAAATAATGA