Identifiers and Description

Gene Model Identifier

TTHERM_00011230

Standard Name

AKM1 (Advancer of K+ through the cell Membrane 1)

Aliases

PreTt11729 | 1.m00777

Description

Conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01465 ) GRIP domain
  • ( PF07885 ) Ion channel
  • ( PF00520 ) transporter, cation channel family
  • ( PF05767 ) Poxvirus virion envelope protein A14
  • ( PF07197 ) Protein of unknown function (DUF1409)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_00011230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02827.13.0001680331469735e-143cation channel family protein
(327 aa)
OxytrichaContig21657.0.g924.999617891954556e-16Ion channel
WormBaseWBGene000129670.0000000000019997478866288316locus:kvs-4 status:Partially
_confirmed UniProt:Q9XXD1
protein_id:CAA19530.3
DictyBaseDDB_G02822910.0004000184047659232potA on chromosome: 3 position
5660926 to 5663954
SGDYJL093C0.0007003012208360162TOK1 Outward-rectifier potassi
um channel of the plasma membr
ane with two pore domains in t
andem, each of which forms a f
unctional channel permeable to
potassium; carboxy tail funct
ions to prevent inner gate clo
sures; target of K1 toxin

General Information

Paragraph NoGene NameParagraph Text
46AKM1Tetrahymena thermophilia AKM1 (Advancer of K+ through the cell Membrane) contains one identified functional domain: the ion channel family (E-value 1.8 X 10 〖10〗^(-12)). It is most closely related to Ichthyophthirius multifilis EGR28840.1, a small-conductance, calcium-activated potassium channel protein. It is likely that AKM1 has a similar conformation as this protein. AKM1 is expected to be a tetrameric potassium channel, located in the phospholipid bilayer and contains a “loop” which is involved in the selectivity of ions that may pass through the channel. Paragraph by: Makari Krause and Amanda McQuade (undergraduates), Keck Science Department, Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011230(coding)
ATGGTATCTTTAATAAGATACATCGATATCAACAGAAAAGGAGAACTAATTAATTTACTA
ATGATTAATTTTTAAATCAAAAATAATTTAGAATAATCAAAAATTAATAATTTAATGTAA
AATATGAAGATAATGAGAAATCATAAACTCTATACAATACTGTGCTCAATTAATGGATTA
ATCCAATGTTGTGAAAGCTATTATTTCACAAAGTAGACTTTGACATAATAAGAAGATAAT
CTAATTATATTGCTCAATCAAAATGAAGATGCAGTCTTTTTTTTTTTAAGAATTGTATGC
TTGATATTAAGTTGTGCAAGTGTCTTTTTTTATTATAGAGAGAATAAGAAAAATTTGAAT
ATTGTTACCATTCTTATTTTACTTATTTGCACACCTCCAAGAGTGAATGCTATTGTTCAT
ATTGAAGTAGATTATCAAATAGACTCTATAATTAGCATATTTTCAACTCTCAAGTTTATT
GAAATTATCAAATATATTTTAATCAATAATGAATATTACAATAAGAAGCATTCTTTTTGG
TTTTCTTTTAAGAGTCTTAACTAGTTTAGACCTTTAATGCTAATTTCATCAATTACCCTT
CTTTTTATTTTTGTTTTCAGTTATATAATATTTGTGCTTGAACTTAACAAACAGCCTGAA
TAATTTAATTCAATATTGTAAAGTGGATATTTTGTTATTGTCGCAGTAACAACAGTCGGT
TATGGAGATCTGATACCTAAAACTTACCTTGGAAAAATATTTACTAATTTTCTATGTCTT
TCAGGTTAAGTTTTATTGAGTCTTCTAGTCATAATACTTATAAGCTTATTCAACCTTACT
GATTAAGATTAAGAAAAAATAAAAGCTTTTGAAAGACCTTATTCAGAAGATAATCAATTT
AGAATGCTTTTAGGAAGGGTTGACATACACTCAAATATATCTAAAGTTTAATAAGGAATT
TTAGATGAATTAGAATTCTTGATAGAATCATTCGAATACTAAAAACAACAATAGGTAAAT
AAATAAATAAATAAATAAATATTCTTTTTTATTATATTTAATCGATGTTTATATAAAACA
TTTTAATAAATCCTAAAATTTATAAATAGAAGCTAGCTAAAATGGTTAAGTGTTGTATAT
CTTCATAAGATTTTATATTTAAATCAGAATAATTTAAATTAATAAATTATTTTTTGGATA
ATTGATATTAAATATACTTAAAAGTAAGTTTTTTCTTTTAAAACTCAAATATTTTAAGAA
AAATAAATAAATCTTTTAAATAATTTAAATAAATTATAGCATAACCAACTAAAATTTTTT
AAATTGAGAATTAAGTTAAAGCTTGGAATAAATCCTCTTTTGTTAATTTAAATAAAATAA
AATAAAAATTGTCAATCCAATAGATAGATTGAGAAATAATATCAAAACCCAGATTAATAA
TAAATATTAGTTAACAATATTTTTTAGATATTTATTAAATAAAACTAAAACATTTAAAAA
ATTTTTTAGGTTAATAATTTTTTGTAAAAAGTAAACTCTTAAAGAATTTGA


>TTHERM_00011230(protein)
MVSLIRYIDINRKGELINLLMINFQIKNNLEQSKINNLMQNMKIMRNHKLYTILCSINGL
IQCCESYYFTKQTLTQQEDNLIILLNQNEDAVFFFLRIVCLILSCASVFFYYRENKKNLN
IVTILILLICTPPRVNAIVHIEVDYQIDSIISIFSTLKFIEIIKYILINNEYYNKKHSFW
FSFKSLNQFRPLMLISSITLLFIFVFSYIIFVLELNKQPEQFNSILQSGYFVIVAVTTVG
YGDLIPKTYLGKIFTNFLCLSGQVLLSLLVIILISLFNLTDQDQEKIKAFERPYSEDNQF
RMLLGRVDIHSNISKVQQGILDELEFLIESFEYQKQQQVNKQINKQIFFFIIFNRCLYKT
FQQILKFINRSQLKWLSVVYLHKILYLNQNNLNQQIIFWIIDIKYTQKQVFSFKTQIFQE
KQINLLNNLNKLQHNQLKFFKLRIKLKLGINPLLLIQIKQNKNCQSNRQIEKQYQNPDQQ
QILVNNIFQIFIKQNQNIQKIFQVNNFLQKVNSQRI


>TTHERM_00011230(gene)
ATGGTATCTTTAATAAGATACATCGATATCAACAGAAAAGGAGAACTAATTAATTTACTA
ATGATTAATTTTTAAATCAAAAATAATTTAGAATAATCAAAAATTAATAATTTAATGTAA
AATATGAAGATAATGAGAAATCATAAACTCTATACAATACTGTGCTCAATTAATGGATTA
ATCCAATGTTGTGAAGTAAATTTTTAAAATAAATGCCTTTGTTGAACCTTACAAAAATAT
TTTGTCTCAATTTCTTACTTAATAAGTAGTTAAAAATTATTTCATACTTAAAATTGTAGA
GCTATTATTTCACAAAGTAGACTTTGACATAATAAGAAGATAATCTAATTATATTGCTCA
ATCAAAATGAAGATGCAGTCTTTTTTTTTTTAAGAATTGTATGCTTGATATTAAGTTGTG
CAAGTGTCTTTTTTTATTATAGAGAGAATAAGAAAAATTTGAATATTGTTACCATTCTTA
TTTTACTTATTTGCACACCTCCAAGAGTGAATGCTATTGTTCATATTGAAGTAGATTATC
AAATAGACTCTATAATTAGCATATTTTCAACTCTCAAGTTTATTGAAATTATCAAATATA
TTTTAATCAATAATGAATATTACAATAAGAAGCATTCTTTTTGGTTTTCTTTTAAGAGTC
TTAACTAGTTTAGACCTTTAATGCTAATTTCATCAATTACCCTTCTTTTTATTTTTGTTT
TCAGTTATATAATATTTGTGCTTGAACTTAACAAACAGCCTGAATAATTTAATTCAATAT
TGTAAAGTAAATTGCCTAAAATTATAAGTAAATATTAGAAAATCTATTTTATATATATTA
GGTGGATATTTTGTTATTGTCGCAGTAACAACAGTCGGTTATGGAGATCTGATACCTAAA
ACTTACCTTGGAAAAATATTTACTAATTTTCTATGTCTTTCAGGTTAAGTTTTATTGAGT
CTTCTAGTCATAATACTTATAAGCTTATTCAACCTTACTGATTAAGATTAAGAAAAAATA
AAAGCTTTTGAAAGACCTTATTCAGAAGATAATCAATTTAGAATGCTTTTAGGAAGGGTT
GACATACACTCAAATATATCTAAAGTTTAATAAGGAATTTTAGATGAATTAGAATTCTTG
ATAGAATCATTCGAATACTAAAAACAACAATAGGTAAATAAATAAATAAATAAATAAATA
TTCTTTTTTATTATATTTAATCGATGTTTATATAAAACATTTTAATAAATCCTAAAATTT
ATAAATAGAAGCTAGCTAAAATGGTTAAGTGTTGTATATCTTCATAAGATTTTATATTTA
AATCAGAATAATTTAAATTAATAAATTATTTTTTGGATAATTGATATTAAATATACTTAA
AAGTAAGTTTTTTCTTTTAAAACTCAAATATTTTAAGAAAAATAAATAAATCTTTTAAAT
AATTTAAATAAATTATAGCATAACCAACTAAAATTTTTTAAATTGAGAATTAAGTTAAAG
CTTGGAATAAATCCTCTTTTGTTAATTTAAATAAAATAAAATAAAAATTGTCAATCCAAT
AGATAGATTGAGAAATAATATCAAAACCCAGATTAATAATAAATATTAGTTAACAATATT
TTTTAGATATTTATTAAATAAAACTAAAACATTTAAAAAATTTTTTAGGTTAATAATTTT
TTGTAAAAAGTAAACTCTTAAAGAATTTGA