Identifiers and Description

Gene Model Identifier

TTHERM_00307700

Standard Name

AIP3 (Asf1-interacting protein)

Aliases

PreTt21273 | 29.m00234 | 3696.m00055

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04564 ) U-box domain
  • ( PF02891 ) MIZ/SP-RING zinc finger
  • ( TIGR00599 ) DNA repair protein rad18
  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( PF06827 ) Zinc finger found in FPG
  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00307700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11635.19.997093137033517e-262hypothetical protein (367 aa)
DictyBaseDDB_G02933004.999245259173412e-21DDB_G0293300 on chromosome: 6
position 2733345 to 2736998
WormBaseWBGene000113650.00000019998969434520019Uncharacterized RING finger pr
otein T02C1.1 status:Partial
ly_confirmed UniProt:Q03605
protein_id:CAA79563.1
OxytrichaContig4056.0.0.g860.00000030014504373857585Zinc finger, C3HC4 type (RING
finger)
SGDYCR066W0.0000029996948234116693RAD18 E3 ubiqutin ligase, form
s heterodimer with Rad6p to mo
noubiquitinate PCNA-K164; hete
rodimer binds single-stranded
DNA and has single-stranded DN
A dependent ATPase activity; r
equired for postreplication re
pair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00307700(coding)
ATGGAACTATCTTAAAACTATTAGAATTATCATTATATACTAGAGCCTGATGATTTTTTA
GCTTTAAAAAACGAAACTAGATGCGCAATATGTTTAGATATTTTTGAGGATCCTGTAACA
ACTTTTTGTTAACATACTTATTGTAAAAAATGCTTAGAAAATCATATTAGAAGTAATGGA
GCTAAATAAGCATTTTGTCCACTTTGCAAGATGCCCGTTGGTAAGAGAAACTACATTCCT
GATAAAAAGGCTCAAGTTTTAGCATCAATAATCTTAAATATAAAGCCGATTAAGAAAATA
CAAATAACTGAAACACCTAAAAAAGACTTACTTTCAACACGCAAAAGAAAAGCTAGCGAG
TTACATCAACCTTTAAAATCTTATGAAATATAATCCAATTAAATTCAAAGTATATAAAAA
AATGAGAATAGTACTATTAGTAGCAGTAATAACAACTCAAAACCAAAAACAAGAAAGAGG
AATGATAAAATAAATATTTTAGTTTCAAACATGCCAGAAGAATTTTAACATGAAGTAGAT
AAATTTTGCAAGCTATATAAGGCTAAGCAATTCAAAGATTATCATGAATAACTCACTCAT
TTAGTTGTATTTCCAATAGATTAAAAAGATGATAAAATAATTGCCAAAAGAACTTTAAAA
TACTTAAGCGCTTTAGTGGAGGGAATATGGATTGTAGGATTTAATTGGATAATACACTCT
AATGGGTACAACGAATTGAAAGATGAAGAAGAATTTGAAGTTTATGGTGATCCTTATGGG
ATTAATACTCCTAGAGAATCTCGTCTTAGAAACGGATTGACAGATCTACTTGAAAACTTA
AGATTTTATATAAGTGAAAAGCAAACAAAAAAAGATTAATAAATAACTAAGAAAGAAATG
GTTTAGCTGATAAAATTAGCAGGAGGAGTCGTAATAGATAATAATAGAGATGAACCAGAA
GAATATTTCCATGTAGTAATAACATCAGGAGCGTAAAATATTGATAAAAATAGTTTAAAA
TCTCTCAAATCATCAAGTAACGATGGCTAAATAATAGTTTCTCATAAATGGCTGTTAGAT
TCAATTAGCAAAGGCTAGCTTTTGAATTACAAAAATTATACCTGA


>TTHERM_00307700(protein)
MELSQNYQNYHYILEPDDFLALKNETRCAICLDIFEDPVTTFCQHTYCKKCLENHIRSNG
AKQAFCPLCKMPVGKRNYIPDKKAQVLASIILNIKPIKKIQITETPKKDLLSTRKRKASE
LHQPLKSYEIQSNQIQSIQKNENSTISSSNNNSKPKTRKRNDKINILVSNMPEEFQHEVD
KFCKLYKAKQFKDYHEQLTHLVVFPIDQKDDKIIAKRTLKYLSALVEGIWIVGFNWIIHS
NGYNELKDEEEFEVYGDPYGINTPRESRLRNGLTDLLENLRFYISEKQTKKDQQITKKEM
VQLIKLAGGVVIDNNRDEPEEYFHVVITSGAQNIDKNSLKSLKSSSNDGQIIVSHKWLLD
SISKGQLLNYKNYT


>TTHERM_00307700(gene)
ATGGAACTATCTTAAAACTATTAGAATTATCATTATATACTAGAGCCTGATGATTTTTTA
GCTTTAAAAAACGAAACTAGATGCGCAATATGGTAATGATAGCTTAATTCACTAATAATT
CTTAAAATTACATTTTAATACTTAAGTTTAGATATTTTTGAGGATCCTGTAACAACTTTT
TGTTAACATACTTATTGTAAAAAATGCTTAGAAAATCATATTAGAAGTAATGGAGCTAAA
TAAGCATTTTGTCCACTTTGCAAGATGCCCGTTGGTAAGAGAAACTACATTCCTGATAAA
AAGGCTCAAGTTTTAGCATCAATAATCTTAAATATAAAGCCGATTAAGAAAATACAAATA
ACTGAAACACCTAAAAAAGACTTACTTTCAACACGCAAAAGAAAAGCTAGCGAGTTACAT
CAACCTTTAAAATGTGAACATGTTTGTTTAATTAATTGATTGATATTTATTTGTTTTAGA
TAAAATGAATTGAGTAAAGTTAAATTCTAAATAATTATATTGAAATAAATTAGCTTATGA
AATATAATCCAATTAAATTCAAAGTATATAAAAAAATGAGAATAGTACTATTAGTAGCAG
TAATAACAACTCAAAACCAAAAGTAAAATTATTAATCAGTTAAGAAAAATAAATAGATTA
ATAAATAAATATTCGTATTAGACAAGAAAGAGGAATGATAAAATAAATATTTTAGTTTCA
AACATGCCAGAAGAATTTTAAGTAAATTTAAAATATTATTTTTGAGCTTATAGATAAATG
TAAATTTTCATGAAAAAGCATGAAGTAGATAAATTTTGCAAGCTATATAAGGCTAAGCAA
TTCAAAGATTATCATGAATAACTCACTCATTTAGTTGTATTTCCAATAGATTAAAAAGAT
GATAAAATAATTGCCAAAAGAACTTTAAAATACTTAAGCGCTTTAGTGGAGGGAATATGG
ATTGTAGGATTTAATTGTAATTTTTAATCTTTCTTATTCTTTTAAATTAAATTCTAAAAA
AAAAAATAGGGATAATACACTCTAATGGGTACAACGAATTGAAAGATGAAGAAGAATTTG
AAGTTTATGGTGATCCTTATGGGATTAATACTCCTAGAGAATCTCGTCTTAGAGTAAACA
TAAAAAAACTAATAAATAAGTTTTTTATTTTTGTATAATTATACAAAGAACGGATTGACA
GATCTACTTGAAAACTTAAGATTTTATATAAGTGAAAAGCAAACAAAAAAAGATTAATAA
ATAACTAAGAAAGAAATGGTTTAGCTGATAAAATTAGCAGGAGGAGTCGTAATAGATAAT
AATAGAGATGAACCAGAAGAATATTTCCATGTAGTAATAACATCAGGAGCGTAAAATATT
GATAAAAATAGTTTAAAATCTCTCAAATCATCAAGTAACGATGGCTAAATAATAGTTTCT
CATAAATGGCTGTTAGATTCAATTAGCAAAGGCTAGCTTTTGAATTACAAAAATTATACC
TGA