Identifiers and Description

Gene Model Identifier

TTHERM_00565630

Standard Name

AIP2 (Asf1-interacting protein)

Aliases

PreTt09002 | 75.m00200 | 3721.m00081

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.6%

TetraMine Data

TTHERM_00565630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14617.19.997093137033517e-262hypothetical protein (2211 aa)
OxytrichaContig6815.0.g779.997093137033517e-262hypothetical protein
Stentor CoeruleusSteCoe_223722.970445045520691e-73
DictyBaseDDB_G02912292.9994376937714457e-52abpF on chromosome: 6 position
145941 to 153138

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_00565630(coding)
ATGTCAATTAAAGAAGAACTCTACGAACAGTACTTGTTAAGTGAGTCAAAAGCTGATTTC
ATAAGCAATCTTATTCCTGATTCATATGAACACCTATACTTCTAAGTCTTACATTCTTTG
AATACTAAGTCTACTTTAACAGAAGAAGATGTCAAGATCTTGACAAAACTTAGAACAAAC
TATGCTCAAGGTAAGCATGAAAACTATTCTCTTCATAATTTAGACTTCTTAAATCTCCTA
AGAGTCCTTGACTCTTAAAAGAGTACCACAGCTTAGAGAGAATAAGCCCTCAAGGATCTC
AAAAACTACTTTAATATCAAATTTAGTGCTATCAAGCCTAATTCAGTATAAGGAAATGAA
ATCCACTAATCAGATATATTGTTAGGAACTTAACTTGAAACTTCTCTTGATCAAAAACTA
ATCAGCTTCCAAAATTATTTGAATTAAGCCTACACCAGTCAGCACATTCTAAGTAACATT
GTCCCTTAAGCTCTCTACAAACTAGATGTGGAAAGACTGCTTACAGAAGCTAAAAATGAA
AAGAATTATGCATAAATACTTGAAGCTTTTGTTTCTAATGTCCCTTGTCTCCATCAAGTT
AAAGATGTCCCCAAAATATACAAGGCTATTTATGATGACTACTAAAAGAGAAAGCTCGTA
TTTGACTTTCAGTAAGCTGGCTATGACAGATTGAGTTTATCATAACTCAAAGAATTTGGT
ACTTTAATGAAAGACGTAGTTTTCGAAACATTTGAATATCAACTTGCCTTAATGAAGAAA
CTTTTCTTTAGAGATGTCAGTAAATTTTTAAATAAATAAAACCTCTCTTTAACATAAGAA
GATAAATAAGAGAAGAAGAAGTAATACACACTTATCTTGACCTGGGTTAAAAGCAACTTA
CCTAGGAAACTCTAGTACTTGCAAAGACTTTTAGTTTAGGAGCTAGTTTTATTGAATTTA
GAATTAAAGGATTACAACTAAGAATTATTCTTAGAATTTATCACAAATCCTCCTATTATT
ATTAACTAATTCACAAATACTTAAAGAGAAAGATACTAATAAAATATTGTGTAGCCAAAT
AGAGATTGGAGTTAAATCTTTTAATTCTCAAGTCTTAATTCTACCTAGTTATTAAGCACA
GTAGAAAATTATCTCCTTTTCTTTTATAGAACTGCTGATAGTATTAAACCTTTCGACTCT
ATTTTAGAATAGTATTACTTAAATAAGACATTTTACAAATCTAAAATTTTAAGTGGTTAG
TAAGAGTATATTACCAAATCAACTTCAGTTTACTCCTAGTCAGAAATAGAAAGCTTAGTT
AACTCAAGATAGATTAATATCCTAGATAGCAACAATAGATATGTTAAGGGTAATGAATAA
GTAAAATTGCAAGTTGAGGTAAAGAACATTTAAAACTTGACAGTGAACATCTTTGAAATA
AAAACTGGAAATTATTATATGGAGAAGATGACTTAATTTGATAATACCATTAGCCTTGAT
GGACTTATTCCTTTACATACTACAGAGTATACTTATAAAGAATCTTCTAACTAGTTGGTT
TTGAGAGAATTTAACTTGGAGCCTATTTAAAAAGCTGAAAGAGGTATTTTCATCGTTGAA
TTCTTTGGTAACTCAATATCTTCTAGAGCTGTCTTTAAAAAAGGACTTTTAAATATTGTG
TCAATTCCTACAATTGCAGGACACTTGATCACTATTGTTGATGAGTCATAAAATATCTGC
AAACCCACTTAAGAAAGTAAAACTGGTATTTTGAAGGATGGAAGATTCTTTAGCGCAGAT
GAAAATGGTTAGATCATAATTCCATATGAAAGCACTCAAAGAACATACTAATTAATATTA
ACTCATAATGACTTCTCAGAAATAGAATCCTTCGATGTATTAACTGAATATTACAATTTC
GAATGTACTTATATGTATAACTAGGAATCTTTCTTATAAGGTAATAAATCTAAAGTTATC
ATCCACCCTACTTTGAGTGTCAACGGCTTACCTGCTGATATGGACATAATAGAAGACTAA
CTTATTAAAGTAAATATAAAAAATCATTAGGATATTCCAACAGCAATTGAGTTTAAAGAT
TTCAAATTTAGCAACAAAGAAGATATTTAAATAGAAATTCCTATTCAAAGCATTATCAAA
TCAATAGAAATAGAGTGCACAGGAGTTATAAATAAAATGGATGGAACTAAATAAAACTTA
GTTAGCAATAATAAACTTACATTCGAATTGCACCAAGTACCTCAAAACTAGATCTTTAAT
TTGTACTTAAAGAATACCCATTCTCATGGATATGTTGTTTATGCTCTTGACAAAACTGGA
TAGCCTTTAGAAAAAGTACCTATTGAATTTTAATTGTTCCATAAAAAAATTTATCAAAAC
TTCACAAGCATGCTTCAAACAGATGCTGAAGGTAAAGCAATTCTTGGTTAATTGGATAAC
ATCAACAGCATTACTGCCCAAGTCAAAGACTTTAAAAACTTCCCTGACATCCATTAAAAT
TGGGTTATAATGCAAAATTACAAGACAGAATTACCATCAAATATTACTATTACTGAAGAA
GAAACTGTTGAAATTCCTATACCTAGTAATGTTTAATTGAGTCGTGAAAACATTACATTC
TACTCTGTGAATTAAGACATTTAGGAATTTGTATATGAAGATCTTTTTGAATAAGTTAAA
TAAGTAACTGGTTTCTTAAGAATATCTAACTTAAAACAAGGAGTCTACATCCTTCATATC
TTGGAGCTATAATCCTACATCACTATTAATGTTTACAGAGGTAGTTATTGGACTCATAAT
AAGTCATTCTTAATAACTGATAATAAATTCATCTAGGTTGATAGATCTAGAGAAAATTTA
ATCTCAATCAAAGAAACACTTCTAGTCCCTTAATCTGAAACTGAAGCAGATATTTTAGTT
AACCTAAACTTACCTGAAAGTATTAGTGAAGCTTAAAGAAACAAGATTAGAGTTCATGTT
TTCGCCTTTAATTACTTATCAAATGACTAAGATAACTTTGTATAAAGTTTAAGAAATAAC
AGAATTCACAAGCCTGAAGTTGTTATAAGCATCCAATCATAAGCAGCAAGCTTCTTCAAC
AATAAAAAAATTGGTGATGAAATATGTTATGTCTACAATAGAAAAAATGAACTTAAAAGA
ATAGGAAACACTCTTGAAAAACCTTAAGTTTTACTTAAGAGAACATTTAATAGAGATACA
TCTTTTGAAAAGGAAAACTTAGAGATAGGTTAAGATTTCTAGAATGTTTCTGAAGTTTAA
TAAGAATCAATCAAAAAATCAAAAAAAGATATGAGATATTATGATTGCTCTGGTAGTGAA
AGGTATTGTGCTGATATTTAAGTTTGCCCTCCAGGAGCATGTCATGTTAAGGGAGAAATA
GATTCCTTTTTAAATTTCTTGAAGAATGCATGCTTTGTGACTTCAAACCATTAAATCTAA
CAAGATGGATCAGTAATTATTCCAGGCTTTTAATGGAAGAATTACTCTAGCATTCAAGTA
GTTGTAACAAGTAATAACTTAGCAATTTCTGACATTTTCCCCACTACATCATCTGAAACT
CCTACATAAGATCTTAGACACGTATCTTCTATGAAGCCAGATTAATTTTACACTGAAAAC
TTTAGCTCAGGTAAATTGAATGCCAGTTAAACTTTGTCGATTTCTGCTGATAGCCAAACT
GCAGTTGTTGGAAGTATTCCTGAAATTTTTGAAATCTAAAAATAATTAATGAAAACAGGA
AGAAAAACTGATGAATATAACGGAAAGAGTTATAGCACTTGGTAGTTTTTGAAAGAATGG
ATAACTTTTACAGATAGATAGAAATTAGATAAGTATAATGAATTCGCATCTCATGAATTA
AACCTTTTCCTTTACTTCAAAGATAATAATTTCTTTAAAGTAGTGGTAGAGCCTTTCTTA
AAAAATAAAATTTAAAAGTCTTTTATTGACTATTTCCTTCTTGGTAATAAAGAAGAATAG
CTTAAATACTCTAATACTGAAAGGGTCAGCGAGTTAAATACCCTTGAATAAGTACTTCTT
ATCATCACCTTAGTGAAAAATAACTTAAAGTAAAGAGCTGAATGTTTAGCTTCATCGATT
GAAAATACATAAAAGACATAAACTAAAAACATTGATTTGTAAAAGAGATTATTCCTCACT
ATCATAGAATCTACAGCAAAAGATGAAATAGTTGTTGCTCAGCAAGTATTAATGGAGTGT
ACAAGCTTTAAATCTATGGCGCAAAAGTCTCGTTGTTATGCAGCAGCACCTATGTAAAAA
ATGTCTCTCAGATCATCAAAAATGGCAGAATAATCAGATTTGTTGGATCTTTAATGTGAA
GCAGAAGAAGCTGATGACTACTTTGGCGGAGGAGGCTCAATGAAGGAGTAACTTATTGAA
AAGAGGAAAGAGTTTAAGGAAGGTTATAAAAAGTTAGAAAATACTAAAGAATATATTGAA
AGACAATATTATTCAGACAATAGAGTAAATAATTATCAAAATTTAGTTTAAGTAAACAAA
TTCTGGAGTGATTTAGCAAGATTTATCGTAAATAATAACGGGATTGAAAATTTTGTAAGT
GAGAATTTTATTTATGGTTTTAATAACCATGTAGAGGCTATCAGTGTCCTATCTCTTATG
GATATTGCTCATACATCTAGAGACAATTATGACCTTAATTCTCTTCCAGGAAGGAAAATT
CAAATAGTTTCATAAAAGAATGTCATTTACTTCTCAAAAGAAATTGTTTAATCATCCGAT
ATAACAAAAGCTAATGTTAGCATAATTTAAACTTTCTTTGATCCTAATGACAGATTCACA
ACTCTTAAGGATGATCCTACAGTCAAAATTGAAAAAGAAGTAGAAGAATTTGTGATTAAC
AAGATTTATGGATGCAAGGTTATCGTCTCTAACATCTCTATAGCTAACTTGAATCTTTCA
ATACTTACTGAAATTCCTGAAGGAGCTATTCCAGTAAATAGCTTCGAATATACTAAAAGT
ATAGACATAACTGTTAACTCTTATCAGACTTACAATAACATTGAATTCTTCTTCTATTTC
CCTAAGGCTGGTACTTTTAATATTTACAGAAGTAACGCCTCCAGAAATGGAATTATTATT
GCTCAAGCCAATGAAATTGCTCCAATAATTGTCAAGCAATTCAATGAAATCAAAAAAATG
GAAAATCTTTCTGATATCCTTAATAATGGCTCCAAAGAAGACATACTTTAGTTTGCCAAA
ACCCAAAACTTGCATGACACATAAGCTTTTAACATAAACAAGATACTCTACATAATATAA
AGCGACAAGCATTTCTTCTTGAGTTTCTTAGAGATTTTAAGAGAATAGGGAGTGTTTAGC
AGGAATGTCTGGGAGTATAGTTTATTCCATAACTACGAATAGGGTGTTATAGAATTACTC
AACAATCAAGAATTTAGAAAGAACAGAATGATTCAAATCTACTAAAATGTCCAATCACAC
AATTCTGACTTACTCAGCTATGATAAATTTTAAGTTTTCGAGTATCACCCCCTCCTTACA
TCTCGTACTCACAGCTTTATGAATTAAAATAAGAGTAAGATCTTGAATGTATAATTCAAG
TAAACATACAATGATTATGTCAACTATCTTGCTCATGTAGCTCAGCCAACTAGCGCCCAT
TATCTTATTTTGAGCTATTACTTGATTCTTTAAGAGCGTATAGATGAAGCTTTGTAAGTA
TTTGGAAAGATCAAAGAGTCAGATTTAACAAATAACTCAAAGATTTAATATGACTACTTT
GCTGCTTACTTAGATATTTACACAGGTGGTCCTAACTTCAAGAGAGCCAGAGAAATCAGT
TAAGCATATCTCGAATATCCTATTATTTCTTGGAGAAATCTCTTCGTAAATATTCAAAAC
TAGCTTACTGAGTATGATGGAGAAGTACTTGATGAGTCTGAAGTTGCAGAAAACACTGAT
CTTAGCAAGAATTTAAAGAATGCCTAAAAAGAACAGTCAATGAACTTTGAAATTCAAGAG
AAGAAGTTAATAGTTTACTATTAAAATGCTGAAAGAGCTACTATTAATCTTTATTAACTT
GATATTGAAGTCCTATTTTCTACTTAACCTTTCATGGAAGGAGGAAACAGAAACGAATTT
ACCTTCATTAAACCCAACCACACAATTAACTTGAATTTCGAAAAGTTGAGCACCCTTGAA
AAGTAAGTAATTGACATTCCAGCTGAATATGCTAATAAAAATCTTTACATTCAACTTGTT
TCCACATCTGGATCCTAAATTCTTTCTTACTTCTCTTCTTCATTAAAGGTCTAAATGATT
GAAAAGTATGGATAAGTAAAAATTCTTGATGAAAAAAATGCCCCCTTACAAAAAGTTTAT
GTTAAGTGCTTTGCTAAATATAAAGATGATTCAGTATAATTCTTCAGAGATGGTTATACC
GACTTGAGAGGAAGATTTGACTATGCTTTAAGCAGTTCTAGTGATATTAATTAAGTTAAG
CAATTTTCTATTTTAATTTCCAGCGAAGAGCATGGATCAATTATCAAAAAAGCCAACCCT
CCCACCCAAACTGGAAGTTTTGAGACTGTAAGCTTACTCAAAAAGAGATGA


>TTHERM_00565630(protein)
MSIKEELYEQYLLSESKADFISNLIPDSYEHLYFQVLHSLNTKSTLTEEDVKILTKLRTN
YAQGKHENYSLHNLDFLNLLRVLDSQKSTTAQREQALKDLKNYFNIKFSAIKPNSVQGNE
IHQSDILLGTQLETSLDQKLISFQNYLNQAYTSQHILSNIVPQALYKLDVERLLTEAKNE
KNYAQILEAFVSNVPCLHQVKDVPKIYKAIYDDYQKRKLVFDFQQAGYDRLSLSQLKEFG
TLMKDVVFETFEYQLALMKKLFFRDVSKFLNKQNLSLTQEDKQEKKKQYTLILTWVKSNL
PRKLQYLQRLLVQELVLLNLELKDYNQELFLEFITNPPIIINQFTNTQRERYQQNIVQPN
RDWSQIFQFSSLNSTQLLSTVENYLLFFYRTADSIKPFDSILEQYYLNKTFYKSKILSGQ
QEYITKSTSVYSQSEIESLVNSRQINILDSNNRYVKGNEQVKLQVEVKNIQNLTVNIFEI
KTGNYYMEKMTQFDNTISLDGLIPLHTTEYTYKESSNQLVLREFNLEPIQKAERGIFIVE
FFGNSISSRAVFKKGLLNIVSIPTIAGHLITIVDESQNICKPTQESKTGILKDGRFFSAD
ENGQIIIPYESTQRTYQLILTHNDFSEIESFDVLTEYYNFECTYMYNQESFLQGNKSKVI
IHPTLSVNGLPADMDIIEDQLIKVNIKNHQDIPTAIEFKDFKFSNKEDIQIEIPIQSIIK
SIEIECTGVINKMDGTKQNLVSNNKLTFELHQVPQNQIFNLYLKNTHSHGYVVYALDKTG
QPLEKVPIEFQLFHKKIYQNFTSMLQTDAEGKAILGQLDNINSITAQVKDFKNFPDIHQN
WVIMQNYKTELPSNITITEEETVEIPIPSNVQLSRENITFYSVNQDIQEFVYEDLFEQVK
QVTGFLRISNLKQGVYILHILELQSYITINVYRGSYWTHNKSFLITDNKFIQVDRSRENL
ISIKETLLVPQSETEADILVNLNLPESISEAQRNKIRVHVFAFNYLSNDQDNFVQSLRNN
RIHKPEVVISIQSQAASFFNNKKIGDEICYVYNRKNELKRIGNTLEKPQVLLKRTFNRDT
SFEKENLEIGQDFQNVSEVQQESIKKSKKDMRYYDCSGSERYCADIQVCPPGACHVKGEI
DSFLNFLKNACFVTSNHQIQQDGSVIIPGFQWKNYSSIQVVVTSNNLAISDIFPTTSSET
PTQDLRHVSSMKPDQFYTENFSSGKLNASQTLSISADSQTAVVGSIPEIFEIQKQLMKTG
RKTDEYNGKSYSTWQFLKEWITFTDRQKLDKYNEFASHELNLFLYFKDNNFFKVVVEPFL
KNKIQKSFIDYFLLGNKEEQLKYSNTERVSELNTLEQVLLIITLVKNNLKQRAECLASSI
ENTQKTQTKNIDLQKRLFLTIIESTAKDEIVVAQQVLMECTSFKSMAQKSRCYAAAPMQK
MSLRSSKMAEQSDLLDLQCEAEEADDYFGGGGSMKEQLIEKRKEFKEGYKKLENTKEYIE
RQYYSDNRVNNYQNLVQVNKFWSDLARFIVNNNGIENFVSENFIYGFNNHVEAISVLSLM
DIAHTSRDNYDLNSLPGRKIQIVSQKNVIYFSKEIVQSSDITKANVSIIQTFFDPNDRFT
TLKDDPTVKIEKEVEEFVINKIYGCKVIVSNISIANLNLSILTEIPEGAIPVNSFEYTKS
IDITVNSYQTYNNIEFFFYFPKAGTFNIYRSNASRNGIIIAQANEIAPIIVKQFNEIKKM
ENLSDILNNGSKEDILQFAKTQNLHDTQAFNINKILYIIQSDKHFFLSFLEILREQGVFS
RNVWEYSLFHNYEQGVIELLNNQEFRKNRMIQIYQNVQSHNSDLLSYDKFQVFEYHPLLT
SRTHSFMNQNKSKILNVQFKQTYNDYVNYLAHVAQPTSAHYLILSYYLILQERIDEALQV
FGKIKESDLTNNSKIQYDYFAAYLDIYTGGPNFKRAREISQAYLEYPIISWRNLFVNIQN
QLTEYDGEVLDESEVAENTDLSKNLKNAQKEQSMNFEIQEKKLIVYYQNAERATINLYQL
DIEVLFSTQPFMEGGNRNEFTFIKPNHTINLNFEKLSTLEKQVIDIPAEYANKNLYIQLV
STSGSQILSYFSSSLKVQMIEKYGQVKILDEKNAPLQKVYVKCFAKYKDDSVQFFRDGYT
DLRGRFDYALSSSSDINQVKQFSILISSEEHGSIIKKANPPTQTGSFETVSLLKKR


>TTHERM_00565630(gene)
ATGTCAATTAAAGAAGAACTCTACGAACAGTACTTGTTAAGTGAGTCAAAAGCTGATTTC
ATAAGCAATCTTATTCCTGATTCATATGAACACCTATACTTCTAAGTCTTACATTCTTTG
AATACTAAGTCTACTTTAACAGAAGAAGATGTCAAGATCTTGACAAAACTTAGAACAAAC
TATGCTCAAGGTAAGCATGAAAACTATTCTCTTCATAATTTAGACTTCTTAAATCTCCTA
AGAGTCCTTGACTCTTAAAAGAGTACCACAGCTTAGAGAGAATAAGCCCTCAAGGATCTC
AAAAACTACTTTAATATCAAATTTAGTGCTATCAAGCCTAATTCAGTATAAGGAAATGAA
ATCCACTAATCAGATATATTGTTAGGAACTTAACTTGAAACTTCTCTTGATCAAAAACTA
ATCAGCTTCCAAAATTATTTGAATTAAGCCTACACCAGTCAGCACATTCTAAGTAACATT
GTCCCTTAAGCTCTCTACAAACTAGATGTGGAAAGACTGCTTACAGAAGCTAAAAATGAA
AAGAATTATGCATAAATACTTGAAGCTTTTGTTTCTAATGTCCCTTGTCTCCATCAAGTT
AAAGATGTCCCCAAAATATACAAGGCTATTTATGATGACTACTAAAAGAGAAAGCTCGTA
TTTGACTTTCAGTAAGCTGGCTATGACAGATTGAGTTTATCATAACTCAAAGAATTTGGT
ACTTTAATGAAAGACGTAGTTTTCGAAACATTTGAATATCAACTTGCCTTAATGAAGAAA
CTTTTCTTTAGAGTACTTGATTATATTCATTAAAAATTTTATAATTTTTTAAATAAATTA
ATTAAATTCTACATTTACTTTGCTTATCTTCTATTCAGATAAATAGATATTCATTTTAAA
AATTTTATTAGTGAAATTGATTAATTTATTTATTTAGATTATATCTTAGAGATGATATTT
GATTATCACAATATTAACTTTTATGATTAAATAAAATAGGATGTCAGTAAATTTTTAAAT
AAATAAAACCTCTCTTTAACATAAGAAGATAAATAAGAGAAGAAGAAGTAATACACACTT
ATCTTGACCTGGGTTAAAAGCAACTTACCTAGGAAACTCTAGTACTTGCAAAGACTTTTA
GTTTAGGAGCTAGTTTTATTGAATTTAGAATTAAAGGATTACAACTAAGAATTATTCTTA
GAATTTATCACAAATCCTCCTATTATTATTAAGTAATGAATTTGAATCATAAATTTCTTA
TTAAATATTTTTAAATTACTTATAATAGCTAATTCACAAATACTTAAAGAGAAAGATACT
AATAAAATATTGTGTAGCCAAATAGAGATTGGAGTTAAATCTTTTAATTCTCAAGTCTTA
ATTCTACCTAGTTATTAAGCACAGTAGAAAATTATCTCCTTTTCTTTTATAGAACTGCTG
ATAGTATTAAACCTTTCGACTCTATTTTAGAATAGTATTACTTAAATAAGACATTTTACA
AATCTAAAATTTTAAGTGGTTAGTAAGAGTATATTACCAAATCAACTTCAGTTTACTCCT
AGTCAGAAATAGAAAGCTTAGTTAACTCAAGATAGATTAATATCCTAGATAGCAACAATA
GATATGTTAAGGGTAATGAATAAGTAAAATTGCAAGTTGAGGTAAAGAACATTTAAAACT
TGACAGTGAACATCTTTGAAATAAAAACTGGAAATTATTATATGGAGAAGATGACTTAAT
TTGATAATACCATTAGCCTTGATGGACTTATTCCTTTACATACTACAGAGTATACTTATA
AAGAATCTTCTAACTAGTTGGTTTTGAGAGAATTTAACTTGGAGCCTATTTAAAAAGCTG
AAAGAGGTATTTTCATCGTTGAATTCTTTGGTAACTCAATATCTTCTAGAGCTGTCTTTA
AAAAAGGTATTTTGTTTTGCGAATTAAAATATTTTAATTTAACTTTATTTATTTACTTAC
TTAGGACTTTTAAATATTGTGTCAATTCCTACAATTGCAGGACACTTGATCACTATTGTT
GATGAGTCATAAAATATCTGCAAACCCACTTAAGAAAGTAAAACTGGTATTTTGAAGGAT
GGAAGATTCTTTAGCGCAGATGAAAATGGTTAGATCATAATTCCATATGAAAGCACTCAA
AGAACATACTAATTAATATTAACTCATAATGACTTCTCAGAAATAGAATCCTTCGATGTA
TTAACTGAATATTACAATTTCGAATGTACTTATATGTATAACTAGGAATCTTTCTTATAA
GGTAATAAATCTAAAGTTATCATCCACCCTACTTTGAGTGTCAACGGCTTACCTGCTGAT
ATGGACATAATAGAAGACTAACTTATTAAAGTAAATATAAAAAATCATTAGGATATTCCA
ACAGCAATTGAGTTTAAAGATTTCAAATTTAGCAACAAAGAAGATATTTAAATAGAAATT
CCTATTCAAAGCATTATCAAATCAATAGAAATAGAGTGCACAGGAGTTATAAATAAAATG
GATGGAACTAAATAAAACTTAGTTAGCAATAATAAACTTACATTCGAATTGCACCAAGTA
CCTCAAAACTAGATCTTTAATTTGTACTTAAAGAATACCCATTCTCATGGATATGTTGTT
TATGCTCTTGACAAAACTGGATAGCCTTTAGAAAAAGTACCTATTGAATTTTAATTGTTC
CATAAAAAAATTTATCAAAACTTCACAAGCATGCTTCAAACAGATGCTGAAGGTAAAGCA
ATTCTTGGTTAATTGGATAACATCAACAGCATTACTGCCCAAGTCAAAGACTTTAAAAAC
TTCCCTGACATCCATTAAAATTGGGTTATAATGCAAAATTACAAGACAGAATTACCATCA
AATATTACTATTACTGAAGAAGAAACTGTTGAAATTCCTATACCTAGTAATGTTTAATTG
AGTCGTGAAAACATTACATTCTACTCTGTGAATTAAGACATTTAGGAATTTGTATATGAA
GATCTTTTTGAATAAGTTAAATAAGTAACTGGTTTCTTAAGAATATCTAACTTAAAACAA
GGAGTCTACATCCTTCATATCTTGGAGCTATAATCCTACATCACTATTAATGTTTACAGA
GGTAGTTATTGGACTCATAATAAGTCATTCTTAATAACTGATAATAAATTCATCTAGGTA
ACTAGAATTAAATTAATTTACTATATTAACAATTTATTTCAATATAGGTTGATAGATCTA
GAGAAAATTTAATCTCAATCAAAGAAACACTTCTAGTCCCTTAATCTGAAACTGAAGCAG
ATATTTTAGTTAACCTAAACTTACCTGAAAGTATTAGTGAAGCTTAAAGAAACAAGATTA
GAGTTCATGTTTTCGCCTTTAATTACTTATCAAATGACTAAGATAACTTTGTATAAAGTT
TAAGAAATAACAGAATTCACAAGCCTGAAGTTGTTATAAGCATCCAATCATAAGCAGCAA
GCTTCTTCAACAATAAAAAAATTGGTGATGAAATATGTTATGTCTACAATAGAAAAAATG
AACTTAAAAGAATAGGAAACACTCTTGAAAAACCTTAAGTTTTACTTAAGAGAACATTTA
ATAGAGATACATCTTTTGAAAAGGAAAACTTAGAGATAGGTTAAGATTTCTAGAATGTTT
CTGAAGTTTAATAAGAATCAATCAAAAAATCAAAAAAAGATATGAGATATTATGATTGCT
CTGGTAGTGAAAGGTATTGTGCTGATATTTAAGTTTGCCCTCCAGGAGCATGTCATGTTA
AGGGAGAAATAGATTCCTTTTTAAATTTCTTGAAGAATGCATGCTTTGTGACTTCAAACC
ATTAAATCTAACAAGATGGATCAGTAATTATTCCAGGCTTTTAATGGAAGAATTACTCTA
GCATTCAAGTAGTTGTAACAAGTAATAACTTAGCAATTTCTGACATTTTCCCCACTACAT
CATCTGAAACTCCTACATAAGATCTTAGACACGTATCTTCTATGAAGCCAGATTAAGTAA
AAATTTTTATTTCTTAATTGATAAAATTATTTCTATAGAATATTAAACAAATCTTAATTA
TATAGTTTTACACTGAAAACTTTAGCTCAGGTAAATTGAATGCCAGTTAAACTTTGTCGA
TTTCTGCTGATAGCCAAACTGCAGTTGTTGGAAGTATTCCTGAAATTTTTGAAATCTAAA
AATAATTAATGAAAACAGGAAGAAAAACTGATGAATATAACGGAAAGAGTTATAGCACTT
GGTAGTTTTTGAAAGAATGGATAACTTTTACAGATAGATAGAAATTAGATAAGTATAATG
AATTCGCATCTCATGAATTAAACCTTTTCCTTTACTTCAAAGATAATAATTTCTTTAAAG
TAGTGGTAGAGCCTTTCTTAAAAAATAAAATTTAAAAGTCTTTTATTGACTATTTCCTTC
TTGGTAATAAAGAAGAATAGCTTAAATACTCTAATACTGAAAGGGTCAGCGAGTTAAATA
CCCTTGAATAAGTACTTCTTATCATCACCTTAGTGAAAAATAACTTAAAGTAAAGAGCTG
AATGTTTAGCTTCATCGATTGAAAATACATAAAAGACATAAACTAAAAACATTGATTTGT
AAAAGAGATTATTCCTCACTATCATAGAATCTACAGCAAAAGATGAAATAGTTGTTGCTC
AGCAAGTATTAATGGAGTGTACAAGCTTTAAATCTATGGCGCAAAAGTCTCGTTGTTATG
CAGCAGCACCTATGTAAAAAATGTCTCTCAGATCATCAAAAATGGCAGAATAATCAGATT
TGTTGGATCTTTAATGTGAAGCAGAAGAAGCTGATGACTACTTTGGCGGAGGAGGCTCAA
TGAAGGAGTAACTTATTGAAAAGAGGAAAGAGTTTAAGGAAGGTTATAAAAAGTTAGAAA
ATACTAAAGAATATATTGAAAGACAATATTATTCAGACAATAGAGTAAATAATTATCAAA
ATTTAGTTTAAGTAAACAAATTCTGGAGTGATTTAGCAAGATTTATCGTAAATAATAACG
GGATTGAAAATTTTGTAAGTGAGAATTTTATTTATGGTTTTAATAACCATGTAGAGGCTA
TCAGTGTCCTATCTCTTATGGATATTGCTCATACATCTAGAGACAATTATGACCTTAATT
CTCTTCCAGGAAGGAAAATTCAAATAGTTTCATAAAAGAATGTCATTTACTTCTCAAAAG
AAATTGTTTAATCATCCGATATAACAAAAGTAAATTGAATTTCTTTATTTATCATTTAAA
ATAAAATTTCTTAAAAAATTAATTAAAAAAATTAAAAAATAGTTTTCAATTTAATTTTAT
AATAAAATTATTTTTTAATCTAAATCTAGGCTAATGTTAGCATAATTTAAACTTTCTTTG
ATCCTAATGACAGATTCACAACTCTTAAGGATGATCCTACAGTCAAAATTGAAAAAGAAG
TAGAAGAATTTGTGATTAACAAGATTTATGGATGCAAGGTTATCGTCTCTAACATCTCTA
TAGCTAACTTGAATCTTTCAATACTTACTGAAATTCCTGAAGGAGCTATTCCAGTAAATA
GCTTCGAATATACTAAAAGTATAGACATAACTGTTAACTCTTATCAGACTTACAATAACA
TTGAATTCTTCTTCTATTTCCCTAAGGCTGGTACTTTTAATATTTACAGAAGTAACGCCT
CCAGAAATGGAATTATTATTGCTCAAGCCAATGAAATTGCTCCAATAATTGTCAAGCAAT
TCAATGAAATCAAAAAAATGGAAAATCTTTCTGATATCCTTAATAATGGCTCCAAAGAAG
ACATACTTTAGTTTGCCAAAACCCAAAACTTGCATGACACATAAGCTTTTAACATAAACA
AGATACTCTACATAATATAAAGCGACAAGGTAATTAGATATTTTATTTAACCAAAATTTA
GATTTTTAAAATGTAATAAAAACTTATAATAATAGCATTTCTTCTTGAGTTTCTTAGAGA
TTTTAAGAGAATAGGGAGTGTTTAGCAGGAATGTCTGGGAGTATAGTTTATTCCATAACT
ACGAATAGGGTGTTATAGAATTACTCAACAATCAAGAATTTAGAAAGAACAGAATGATTC
AAATCTACTAAAATGTCCAATCACACAATTCTGACTTACTCAGCTATGATAAATTTTAAG
TTTTCGAGTATCACCCCCTCCTTACATCTCGTACTCACAGCTTTATGAATTAAAATAAGA
GTAAGATCTTGAATGTATAATTCAAGTAAACATACAATGATTATGTCAACTATCTTGCTC
ATGTAGCTCAGCCAACTGTAAATAAAATTATTAAAAAAATTATTTTTATTTATTTATTCA
TGCCTTTATTAAAAATAAGAGCGCCCATTATCTTATTTTGAGCTATTACTTGATTCTTTA
AGAGCGTATAGATGAAGCTTTGTAAGTATTTGGAAAGATCAAAGAGTCAGATTTAACAAA
TAACTCAAAGATTTAATATGACTACTTTGCTGCTTACTTAGATATTTACACAGGTGGTCC
TAACTTCAAGAGAGCCAGAGAAATCAGTTAAGCATATCTCGAATATCCTATTATTTCTTG
GAGAAATCTCTTCGTAAATATTCAAAACTAGCTTACTGAGTATGATGGAGAAGTACTTGA
TGAGTCTGAAGTTGCAGAAAACACTGATCTTAGCAAGGTAATTTTAAACTTAAGAAAATT
TTAATGAATTAATAACAATTAATTTTAAAAGAATTTAAAGAATGCCTAAAAAGAACAGTC
AATGAACTTTGAAATTCAAGAGAAGAAGTTAATAGTTTACTATTAAAATGCTGAAAGAGC
TACTATTAATCTTTATTAACTTGATATTGAAGTCCTATTTTCTACTTAACCTTTCATGGA
AGGAGGAAACAGAAACGAATTTACCTTCATTAAACCCAACCACACAATTAACTTGAATTT
CGAAAAGTTGAGCACCCTTGAAAAGTAAGTAATTGACATTCCAGCTGAATATGCTAATAA
AAATCTTTACATTCAACTTGTTTCCACATCTGGATCCTAAATTCTTTCTTACTTCTCTTC
TTCATTAAAGGTCTAAATGATTGAAAAGTATGGATAAGTAAAAATTCTTGATGAAAAAAA
TGCCCCCTTACAAAAAGTACTTTTTTTTAAATTTATAATAAAAAATAAGCATAATTTATT
CTATAAATAGGTTTATGTTAAGTGCTTTGCTAAATATAAAGATGATTCAGTATAATTCTT
CAGAGATGGTTATACCGACTTGAGAGGAAGATTTGACTATGCTTTAAGCAGTTCTAGTGA
TATTAATTAAGTTAAGCAATTTTCTATTTTAATTTCCAGCGAAGAGCATGGATCAATTAT
CAAAAAAGCCAACCCTCCCACCCAAACTGGAAGTTTTGAGACTGTAAGCTTACTCAAAAA
GAGATGA