Identifiers and Description

Gene Model Identifier

TTHERM_00565630

Standard Name

AIP2 (Asf1-Interacting Protein 2)

Aliases

PreTt09002 | 75.m00200 | 3721.m00081

Description

AIP2 hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.6%

TetraMine Data

TTHERM_00565630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14617.19.997093137033517e-262hypothetical protein (2211 aa)
OxytrichaContig6815.0.g779.997093137033517e-262hypothetical protein
Stentor CoeruleusSteCoe_223722.970445045520691e-73
DictyBaseDDB_G02912292.9994376937714457e-52abpF on chromosome: 6 position
145941 to 153138

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_00565630(coding)
ATGTCAATTAAAGAAGAACTCTACGAACAGTACTTGTTAAGTGAGTCAAAAGCTGATTTC
ATAAGCAATCTTATTCCTGATTCATATGAACACCTATACTTCTAAGTCTTACATTCTTTG
AATACTAAGTCTACTTTAACAGAAGAAGATGTCAAGATCTTGACAAAACTTAGAACAAAC
TATGCTCAAGGTAAGCATGAAAACTATTCTCTTCATAATTTAGACTTCTTAAATCTCCTA
AGAGTCCTTGACTCTTAAAAGAGTACCACAGCTTAGAGAGAATAAGCCCTCAAGGATCTC
AAAAACTACTTTAATATCAAATTTAGTGCTATCAAGCCTAATTCAGTATAAGGAAATGAA
ATCCACTAATCAGATATATTGTTAGGAACTTAACTTGAAACTTCTCTTGATCAAAAACTA
ATCAGCTTCCAAAATTATTTGAATTAAGCCTACACCAGTCAGCACATTCTAAGTAACATT
GTCCCTTAAGCTCTCTACAAACTAGATGTGGAAAGACTGCTTACAGAAGCTAAAAATGAA
AAGAATTATGCATAAATACTTGAAGCTTTTGTTTCTAATGTCCCTTGTCTCCATCAAGTT
AAAGATGTCCCCAAAATATACAAGGCTATTTATGATGACTACTAAAAGAGAAAGCTCGTA
TTTGACTTTCAGTAAGCTGGCTATGACAGATTGAGTTTATCATAACTCAAAGAATTTGGT
ACTTTAATGAAAGACGTAGTTTTCGAAACATTTGAATATCAACTTGCCTTAATGAAGAAA
CTTTTCTTTAGAGATGTCAGTAAATTTTTAAATAAATAAAACCTCTCTTTAACATAAGAA
GATAAATAAGAGAAGAAGAAGTAATACACACTTATCTTGACCTGGGTTAAAAGCAACTTA
CCTAGGAAACTCTAGTACTTGCAAAGACTTTTAGTTTAGGAGCTAGTTTTATTGAATTTA
GAATTAAAGGATTACAACTAAGAATTATTCTTAGAATTTATCACAAATCCTCCTATTATT
ATTAACTAATTCACAAATACTTAAAGAGAAAGATACTAATAAAATATTGTGTAGCCAAAT
AGAGATTGGAGTTAAATCTTTTAATTCTCAAGTCTTAATTCTACCTAGTTATTAAGCACA
GTAGAAAATTATCTCCTTTTCTTTTATAGAACTGCTGATAGTATTAAACCTTTCGACTCT
ATTTTAGAATAGTATTACTTAAATAAGACATTTTACAAATCTAAAATTTTAAGTGGTTAG
TAAGAGTATATTACCAAATCAACTTCAGTTTACTCCTAGTCAGAAATAGAAAGCTTAGTT
AACTCAAGATAGATTAATATCCTAGATAGCAACAATAGATATGTTAAGGGTAATGAATAA
GTAAAATTGCAAGTTGAGGTAAAGAACATTTAAAACTTGACAGTGAACATCTTTGAAATA
AAAACTGGAAATTATTATATGGAGAAGATGACTTAATTTGATAATACCATTAGCCTTGAT
GGACTTATTCCTTTACATACTACAGAGTATACTTATAAAGAATCTTCTAACTAGTTGGTT
TTGAGAGAATTTAACTTGGAGCCTATTTAAAAAGCTGAAAGAGGTATTTTCATCGTTGAA
TTCTTTGGTAACTCAATATCTTCTAGAGCTGTCTTTAAAAAAGGACTTTTAAATATTGTG
TCAATTCCTACAATTGCAGGACACTTGATCACTATTGTTGATGAGTCATAAAATATCTGC
AAACCCACTTAAGAAAGTAAAACTGGTATTTTGAAGGATGGAAGATTCTTTAGCGCAGAT
GAAAATGGTTAGATCATAATTCCATATGAAAGCACTCAAAGAACATACTAATTAATATTA
ACTCATAATGACTTCTCAGAAATAGAATCCTTCGATGTATTAACTGAATATTACAATTTC
GAATGTACTTATATGTATAACTAGGAATCTTTCTTATAAGGTAATAAATCTAAAGTTATC
ATCCACCCTACTTTGAGTGTCAACGGCTTACCTGCTGATATGGACATAATAGAAGACTAA
CTTATTAAAGTAAATATAAAAAATCATTAGGATATTCCAACAGCAATTGAGTTTAAAGAT
TTCAAATTTAGCAACAAAGAAGATATTTAAATAGAAATTCCTATTCAAAGCATTATCAAA
TCAATAGAAATAGAGTGCACAGGAGTTATAAATAAAATGGATGGAACTAAATAAAACTTA
GTTAGCAATAATAAACTTACATTCGAATTGCACCAAGTACCTCAAAACTAGATCTTTAAT
TTGTACTTAAAGAATACCCATTCTCATGGATATGTTGTTTATGCTCTTGACAAAACTGGA
TAGCCTTTAGAAAAAGTACCTATTGAATTTTAATTGTTCCATAAAAAAATTTATCAAAAC
TTCACAAGCATGCTTCAAACAGATGCTGAAGGTAAAGCAATTCTTGGTTAATTGGATAAC
ATCAACAGCATTACTGCCCAAGTCAAAGACTTTAAAAACTTCCCTGACATCCATTAAAAT
TGGGTTATAATGCAAAATTACAAGACAGAATTACCATCAAATATTACTATTACTGAAGAA
GAAACTGTTGAAATTCCTATACCTAGTAATGTTTAATTGAGTCGTGAAAACATTACATTC
TACTCTGTGAATTAAGACATTTAGGAATTTGTATATGAAGATCTTTTTGAATAAGTTAAA
TAAGTAACTGGTTTCTTAAGAATATCTAACTTAAAACAAGGAGTCTACATCCTTCATATC
TTGGAGCTATAATCCTACATCACTATTAATGTTTACAGAGGTAGTTATTGGACTCATAAT
AAGTCATTCTTAATAACTGATAATAAATTCATCTAGGTTGATAGATCTAGAGAAAATTTA
ATCTCAATCAAAGAAACACTTCTAGTCCCTTAATCTGAAACTGAAGCAGATATTTTAGTT
AACCTAAACTTACCTGAAAGTATTAGTGAAGCTTAAAGAAACAAGATTAGAGTTCATGTT
TTCGCCTTTAATTACTTATCAAATGACTAAGATAACTTTGTATAAAGTTTAAGAAATAAC
AGAATTCACAAGCCTGAAGTTGTTATAAGCATCCAATCATAAGCAGCAAGCTTCTTCAAC
AATAAAAAAATTGGTGATGAAATATGTTATGTCTACAATAGAAAAAATGAACTTAAAAGA
ATAGGAAACACTCTTGAAAAACCTTAAGTTTTACTTAAGAGAACATTTAATAGAGATACA
TCTTTTGAAAAGGAAAACTTAGAGATAGGTTAAGATTTCTAGAATGTTTCTGAAGTTTAA
TAAGAATCAATCAAAAAATCAAAAAAAGATATGAGATATTATGATTGCTCTGGTAGTGAA
AGGTATTGTGCTGATATTTAAGTTTGCCCTCCAGGAGCATGTCATGTTAAGGGAGAAATA
GATTCCTTTTTAAATTTCTTGAAGAATGCATGCTTTGTGACTTCAAACCATTAAATCTAA
CAAGATGGATCAGTAATTATTCCAGGCTTTTAATGGAAGAATTACTCTAGCATTCAAGTA
GTTGTAACAAGTAATAACTTAGCAATTTCTGACATTTTCCCCACTACATCATCTGAAACT
CCTACATAAGATCTTAGACACGTATCTTCTATGAAGCCAGATTAATTTTACACTGAAAAC
TTTAGCTCAGGTAAATTGAATGCCAGTTAAACTTTGTCGATTTCTGCTGATAGCCAAACT
GCAGTTGTTGGAAGTATTCCTGAAATTTTTGAAATCTAAAAATAATTAATGAAAACAGGA
AGAAAAACTGATGAATATAACGGAAAGAGTTATAGCACTTGGTAGTTTTTGAAAGAATGG
ATAACTTTTACAGATAGATAGAAATTAGATAAGTATAATGAATTCGCATCTCATGAATTA
AACCTTTTCCTTTACTTCAAAGATAATAATTTCTTTAAAGTAGTGGTAGAGCCTTTCTTA
AAAAATAAAATTTAAAAGTCTTTTATTGACTATTTCCTTCTTGGTAATAAAGAAGAATAG
CTTAAATACTCTAATACTGAAAGGGTCAGCGAGTTAAATACCCTTGAATAAGTACTTCTT
ATCATCACCTTAGTGAAAAATAACTTAAAGTAAAGAGCTGAATGTTTAGCTTCATCGATT
GAAAATACATAAAAGACATAAACTAAAAACATTGATTTGTAAAAGAGATTATTCCTCACT
ATCATAGAATCTACAGCAAAAGATGAAATAGTTGTTGCTCAGCAAGTATTAATGGAGTGT
ACAAGCTTTAAATCTATGGCGCAAAAGTCTCGTTGTTATGCAGCAGCACCTATGTAAAAA
ATGTCTCTCAGATCATCAAAAATGGCAGAATAATCAGATTTGTTGGATCTTTAATGTGAA
GCAGAAGAAGCTGATGACTACTTTGGCGGAGGAGGCTCAATGAAGGAGTAACTTATTGAA
AAGAGGAAAGAGTTTAAGGAAGGTTATAAAAAGTTAGAAAATACTAAAGAATATATTGAA
AGACAATATTATTCAGACAATAGAGTAAATAATTATCAAAATTTAGTTTAAGTAAACAAA
TTCTGGAGTGATTTAGCAAGATTTATCGTAAATAATAACGGGATTGAAAATTTTGTAAGT
GAGAATTTTATTTATGGTTTTAATAACCATGTAGAGGCTATCAGTGTCCTATCTCTTATG
GATATTGCTCATACATCTAGAGACAATTATGACCTTAATTCTCTTCCAGGAAGGAAAATT
CAAATAGTTTCATAAAAGAATGTCATTTACTTCTCAAAAGAAATTGTTTAATCATCCGAT
ATAACAAAAGCTAATGTTAGCATAATTTAAACTTTCTTTGATCCTAATGACAGATTCACA
ACTCTTAAGGATGATCCTACAGTCAAAATTGAAAAAGAAGTAGAAGAATTTGTGATTAAC
AAGATTTATGGATGCAAGGTTATCGTCTCTAACATCTCTATAGCTAACTTGAATCTTTCA
ATACTTACTGAAATTCCTGAAGGAGCTATTCCAGTAAATAGCTTCGAATATACTAAAAGT
ATAGACATAACTGTTAACTCTTATCAGACTTACAATAACATTGAATTCTTCTTCTATTTC
CCTAAGGCTGGTACTTTTAATATTTACAGAAGTAACGCCTCCAGAAATGGAATTATTATT
GCTCAAGCCAATGAAATTGCTCCAATAATTGTCAAGCAATTCAATGAAATCAAAAAAATG
GAAAATCTTTCTGATATCCTTAATAATGGCTCCAAAGAAGACATACTTTAGTTTGCCAAA
ACCCAAAACTTGCATGACACATAAGCTTTTAACATAAACAAGATACTCTACATAATATAA
AGCGACAAGCATTTCTTCTTGAGTTTCTTAGAGATTTTAAGAGAATAGGGAGTGTTTAGC
AGGAATGTCTGGGAGTATAGTTTATTCCATAACTACGAATAGGGTGTTATAGAATTACTC
AACAATCAAGAATTTAGAAAGAACAGAATGATTCAAATCTACTAAAATGTCCAATCACAC
AATTCTGACTTACTCAGCTATGATAAATTTTAAGTTTTCGAGTATCACCCCCTCCTTACA
TCTCGTACTCACAGCTTTATGAATTAAAATAAGAGTAAGATCTTGAATGTATAATTCAAG
TAAACATACAATGATTATGTCAACTATCTTGCTCATGTAGCTCAGCCAACTAGCGCCCAT
TATCTTATTTTGAGCTATTACTTGATTCTTTAAGAGCGTATAGATGAAGCTTTGTAAGTA
TTTGGAAAGATCAAAGAGTCAGATTTAACAAATAACTCAAAGATTTAATATGACTACTTT
GCTGCTTACTTAGATATTTACACAGGTGGTCCTAACTTCAAGAGAGCCAGAGAAATCAGT
TAAGCATATCTCGAATATCCTATTATTTCTTGGAGAAATCTCTTCGTAAATATTCAAAAC
TAGCTTACTGAGTATGATGGAGAAGTACTTGATGAGTCTGAAGTTGCAGAAAACACTGAT
CTTAGCAAGAATTTAAAGAATGCCTAAAAAGAACAGTCAATGAACTTTGAAATTCAAGAG
AAGAAGTTAATAGTTTACTATTAAAATGCTGAAAGAGCTACTATTAATCTTTATTAACTT
GATATTGAAGTCCTATTTTCTACTTAACCTTTCATGGAAGGAGGAAACAGAAACGAATTT
ACCTTCATTAAACCCAACCACACAATTAACTTGAATTTCGAAAAGTTGAGCACCCTTGAA
AAGTAAGTAATTGACATTCCAGCTGAATATGCTAATAAAAATCTTTACATTCAACTTGTT
TCCACATCTGGATCCTAAATTCTTTCTTACTTCTCTTCTTCATTAAAGGTCTAAATGATT
GAAAAGTATGGATAAGTAAAAATTCTTGATGAAAAAAATGCCCCCTTACAAAAAGTTTAT
GTTAAGTGCTTTGCTAAATATAAAGATGATTCAGTATAATTCTTCAGAGATGGTTATACC
GACTTGAGAGGAAGATTTGACTATGCTTTAAGCAGTTCTAGTGATATTAATTAAGTTAAG
CAATTTTCTATTTTAATTTCCAGCGAAGAGCATGGATCAATTATCAAAAAAGCCAACCCT
CCCACCCAAACTGGAAGTTTTGAGACTGTAAGCTTACTCAAAAAGAGATGA


>TTHERM_00565630(protein)
MSIKEELYEQYLLSESKADFISNLIPDSYEHLYFQVLHSLNTKSTLTEEDVKILTKLRTN
YAQGKHENYSLHNLDFLNLLRVLDSQKSTTAQREQALKDLKNYFNIKFSAIKPNSVQGNE
IHQSDILLGTQLETSLDQKLISFQNYLNQAYTSQHILSNIVPQALYKLDVERLLTEAKNE
KNYAQILEAFVSNVPCLHQVKDVPKIYKAIYDDYQKRKLVFDFQQAGYDRLSLSQLKEFG
TLMKDVVFETFEYQLALMKKLFFRDVSKFLNKQNLSLTQEDKQEKKKQYTLILTWVKSNL
PRKLQYLQRLLVQELVLLNLELKDYNQELFLEFITNPPIIINQFTNTQRERYQQNIVQPN
RDWSQIFQFSSLNSTQLLSTVENYLLFFYRTADSIKPFDSILEQYYLNKTFYKSKILSGQ
QEYITKSTSVYSQSEIESLVNSRQINILDSNNRYVKGNEQVKLQVEVKNIQNLTVNIFEI
KTGNYYMEKMTQFDNTISLDGLIPLHTTEYTYKESSNQLVLREFNLEPIQKAERGIFIVE
FFGNSISSRAVFKKGLLNIVSIPTIAGHLITIVDESQNICKPTQESKTGILKDGRFFSAD
ENGQIIIPYESTQRTYQLILTHNDFSEIESFDVLTEYYNFECTYMYNQESFLQGNKSKVI
IHPTLSVNGLPADMDIIEDQLIKVNIKNHQDIPTAIEFKDFKFSNKEDIQIEIPIQSIIK
SIEIECTGVINKMDGTKQNLVSNNKLTFELHQVPQNQIFNLYLKNTHSHGYVVYALDKTG
QPLEKVPIEFQLFHKKIYQNFTSMLQTDAEGKAILGQLDNINSITAQVKDFKNFPDIHQN
WVIMQNYKTELPSNITITEEETVEIPIPSNVQLSRENITFYSVNQDIQEFVYEDLFEQVK
QVTGFLRISNLKQGVYILHILELQSYITINVYRGSYWTHNKSFLITDNKFIQVDRSRENL
ISIKETLLVPQSETEADILVNLNLPESISEAQRNKIRVHVFAFNYLSNDQDNFVQSLRNN
RIHKPEVVISIQSQAASFFNNKKIGDEICYVYNRKNELKRIGNTLEKPQVLLKRTFNRDT
SFEKENLEIGQDFQNVSEVQQESIKKSKKDMRYYDCSGSERYCADIQVCPPGACHVKGEI
DSFLNFLKNACFVTSNHQIQQDGSVIIPGFQWKNYSSIQVVVTSNNLAISDIFPTTSSET
PTQDLRHVSSMKPDQFYTENFSSGKLNASQTLSISADSQTAVVGSIPEIFEIQKQLMKTG
RKTDEYNGKSYSTWQFLKEWITFTDRQKLDKYNEFASHELNLFLYFKDNNFFKVVVEPFL
KNKIQKSFIDYFLLGNKEEQLKYSNTERVSELNTLEQVLLIITLVKNNLKQRAECLASSI
ENTQKTQTKNIDLQKRLFLTIIESTAKDEIVVAQQVLMECTSFKSMAQKSRCYAAAPMQK
MSLRSSKMAEQSDLLDLQCEAEEADDYFGGGGSMKEQLIEKRKEFKEGYKKLENTKEYIE
RQYYSDNRVNNYQNLVQVNKFWSDLARFIVNNNGIENFVSENFIYGFNNHVEAISVLSLM
DIAHTSRDNYDLNSLPGRKIQIVSQKNVIYFSKEIVQSSDITKANVSIIQTFFDPNDRFT
TLKDDPTVKIEKEVEEFVINKIYGCKVIVSNISIANLNLSILTEIPEGAIPVNSFEYTKS
IDITVNSYQTYNNIEFFFYFPKAGTFNIYRSNASRNGIIIAQANEIAPIIVKQFNEIKKM
ENLSDILNNGSKEDILQFAKTQNLHDTQAFNINKILYIIQSDKHFFLSFLEILREQGVFS
RNVWEYSLFHNYEQGVIELLNNQEFRKNRMIQIYQNVQSHNSDLLSYDKFQVFEYHPLLT
SRTHSFMNQNKSKILNVQFKQTYNDYVNYLAHVAQPTSAHYLILSYYLILQERIDEALQV
FGKIKESDLTNNSKIQYDYFAAYLDIYTGGPNFKRAREISQAYLEYPIISWRNLFVNIQN
QLTEYDGEVLDESEVAENTDLSKNLKNAQKEQSMNFEIQEKKLIVYYQNAERATINLYQL
DIEVLFSTQPFMEGGNRNEFTFIKPNHTINLNFEKLSTLEKQVIDIPAEYANKNLYIQLV
STSGSQILSYFSSSLKVQMIEKYGQVKILDEKNAPLQKVYVKCFAKYKDDSVQFFRDGYT
DLRGRFDYALSSSSDINQVKQFSILISSEEHGSIIKKANPPTQTGSFETVSLLKKR


>TTHERM_00565630(gene)
ATGTCAATTAAAGAAGAACTCTACGAACAGTACTTGTTAAGTGAGTCAAAAGCTGATTTC
ATAAGCAATCTTATTCCTGATTCATATGAACACCTATACTTCTAAGTCTTACATTCTTTG
AATACTAAGTCTACTTTAACAGAAGAAGATGTCAAGATCTTGACAAAACTTAGAACAAAC
TATGCTCAAGGTAAGCATGAAAACTATTCTCTTCATAATTTAGACTTCTTAAATCTCCTA
AGAGTCCTTGACTCTTAAAAGAGTACCACAGCTTAGAGAGAATAAGCCCTCAAGGATCTC
AAAAACTACTTTAATATCAAATTTAGTGCTATCAAGCCTAATTCAGTATAAGGAAATGAA
ATCCACTAATCAGATATATTGTTAGGAACTTAACTTGAAACTTCTCTTGATCAAAAACTA
ATCAGCTTCCAAAATTATTTGAATTAAGCCTACACCAGTCAGCACATTCTAAGTAACATT
GTCCCTTAAGCTCTCTACAAACTAGATGTGGAAAGACTGCTTACAGAAGCTAAAAATGAA
AAGAATTATGCATAAATACTTGAAGCTTTTGTTTCTAATGTCCCTTGTCTCCATCAAGTT
AAAGATGTCCCCAAAATATACAAGGCTATTTATGATGACTACTAAAAGAGAAAGCTCGTA
TTTGACTTTCAGTAAGCTGGCTATGACAGATTGAGTTTATCATAACTCAAAGAATTTGGT
ACTTTAATGAAAGACGTAGTTTTCGAAACATTTGAATATCAACTTGCCTTAATGAAGAAA
CTTTTCTTTAGAGTACTTGATTATATTCATTAAAAATTTTATAATTTTTTAAATAAATTA
ATTAAATTCTACATTTACTTTGCTTATCTTCTATTCAGATAAATAGATATTCATTTTAAA
AATTTTATTAGTGAAATTGATTAATTTATTTATTTAGATTATATCTTAGAGATGATATTT
GATTATCACAATATTAACTTTTATGATTAAATAAAATAGGATGTCAGTAAATTTTTAAAT
AAATAAAACCTCTCTTTAACATAAGAAGATAAATAAGAGAAGAAGAAGTAATACACACTT
ATCTTGACCTGGGTTAAAAGCAACTTACCTAGGAAACTCTAGTACTTGCAAAGACTTTTA
GTTTAGGAGCTAGTTTTATTGAATTTAGAATTAAAGGATTACAACTAAGAATTATTCTTA
GAATTTATCACAAATCCTCCTATTATTATTAAGTAATGAATTTGAATCATAAATTTCTTA
TTAAATATTTTTAAATTACTTATAATAGCTAATTCACAAATACTTAAAGAGAAAGATACT
AATAAAATATTGTGTAGCCAAATAGAGATTGGAGTTAAATCTTTTAATTCTCAAGTCTTA
ATTCTACCTAGTTATTAAGCACAGTAGAAAATTATCTCCTTTTCTTTTATAGAACTGCTG
ATAGTATTAAACCTTTCGACTCTATTTTAGAATAGTATTACTTAAATAAGACATTTTACA
AATCTAAAATTTTAAGTGGTTAGTAAGAGTATATTACCAAATCAACTTCAGTTTACTCCT
AGTCAGAAATAGAAAGCTTAGTTAACTCAAGATAGATTAATATCCTAGATAGCAACAATA
GATATGTTAAGGGTAATGAATAAGTAAAATTGCAAGTTGAGGTAAAGAACATTTAAAACT
TGACAGTGAACATCTTTGAAATAAAAACTGGAAATTATTATATGGAGAAGATGACTTAAT
TTGATAATACCATTAGCCTTGATGGACTTATTCCTTTACATACTACAGAGTATACTTATA
AAGAATCTTCTAACTAGTTGGTTTTGAGAGAATTTAACTTGGAGCCTATTTAAAAAGCTG
AAAGAGGTATTTTCATCGTTGAATTCTTTGGTAACTCAATATCTTCTAGAGCTGTCTTTA
AAAAAGGTATTTTGTTTTGCGAATTAAAATATTTTAATTTAACTTTATTTATTTACTTAC
TTAGGACTTTTAAATATTGTGTCAATTCCTACAATTGCAGGACACTTGATCACTATTGTT
GATGAGTCATAAAATATCTGCAAACCCACTTAAGAAAGTAAAACTGGTATTTTGAAGGAT
GGAAGATTCTTTAGCGCAGATGAAAATGGTTAGATCATAATTCCATATGAAAGCACTCAA
AGAACATACTAATTAATATTAACTCATAATGACTTCTCAGAAATAGAATCCTTCGATGTA
TTAACTGAATATTACAATTTCGAATGTACTTATATGTATAACTAGGAATCTTTCTTATAA
GGTAATAAATCTAAAGTTATCATCCACCCTACTTTGAGTGTCAACGGCTTACCTGCTGAT
ATGGACATAATAGAAGACTAACTTATTAAAGTAAATATAAAAAATCATTAGGATATTCCA
ACAGCAATTGAGTTTAAAGATTTCAAATTTAGCAACAAAGAAGATATTTAAATAGAAATT
CCTATTCAAAGCATTATCAAATCAATAGAAATAGAGTGCACAGGAGTTATAAATAAAATG
GATGGAACTAAATAAAACTTAGTTAGCAATAATAAACTTACATTCGAATTGCACCAAGTA
CCTCAAAACTAGATCTTTAATTTGTACTTAAAGAATACCCATTCTCATGGATATGTTGTT
TATGCTCTTGACAAAACTGGATAGCCTTTAGAAAAAGTACCTATTGAATTTTAATTGTTC
CATAAAAAAATTTATCAAAACTTCACAAGCATGCTTCAAACAGATGCTGAAGGTAAAGCA
ATTCTTGGTTAATTGGATAACATCAACAGCATTACTGCCCAAGTCAAAGACTTTAAAAAC
TTCCCTGACATCCATTAAAATTGGGTTATAATGCAAAATTACAAGACAGAATTACCATCA
AATATTACTATTACTGAAGAAGAAACTGTTGAAATTCCTATACCTAGTAATGTTTAATTG
AGTCGTGAAAACATTACATTCTACTCTGTGAATTAAGACATTTAGGAATTTGTATATGAA
GATCTTTTTGAATAAGTTAAATAAGTAACTGGTTTCTTAAGAATATCTAACTTAAAACAA
GGAGTCTACATCCTTCATATCTTGGAGCTATAATCCTACATCACTATTAATGTTTACAGA
GGTAGTTATTGGACTCATAATAAGTCATTCTTAATAACTGATAATAAATTCATCTAGGTA
ACTAGAATTAAATTAATTTACTATATTAACAATTTATTTCAATATAGGTTGATAGATCTA
GAGAAAATTTAATCTCAATCAAAGAAACACTTCTAGTCCCTTAATCTGAAACTGAAGCAG
ATATTTTAGTTAACCTAAACTTACCTGAAAGTATTAGTGAAGCTTAAAGAAACAAGATTA
GAGTTCATGTTTTCGCCTTTAATTACTTATCAAATGACTAAGATAACTTTGTATAAAGTT
TAAGAAATAACAGAATTCACAAGCCTGAAGTTGTTATAAGCATCCAATCATAAGCAGCAA
GCTTCTTCAACAATAAAAAAATTGGTGATGAAATATGTTATGTCTACAATAGAAAAAATG
AACTTAAAAGAATAGGAAACACTCTTGAAAAACCTTAAGTTTTACTTAAGAGAACATTTA
ATAGAGATACATCTTTTGAAAAGGAAAACTTAGAGATAGGTTAAGATTTCTAGAATGTTT
CTGAAGTTTAATAAGAATCAATCAAAAAATCAAAAAAAGATATGAGATATTATGATTGCT
CTGGTAGTGAAAGGTATTGTGCTGATATTTAAGTTTGCCCTCCAGGAGCATGTCATGTTA
AGGGAGAAATAGATTCCTTTTTAAATTTCTTGAAGAATGCATGCTTTGTGACTTCAAACC
ATTAAATCTAACAAGATGGATCAGTAATTATTCCAGGCTTTTAATGGAAGAATTACTCTA
GCATTCAAGTAGTTGTAACAAGTAATAACTTAGCAATTTCTGACATTTTCCCCACTACAT
CATCTGAAACTCCTACATAAGATCTTAGACACGTATCTTCTATGAAGCCAGATTAAGTAA
AAATTTTTATTTCTTAATTGATAAAATTATTTCTATAGAATATTAAACAAATCTTAATTA
TATAGTTTTACACTGAAAACTTTAGCTCAGGTAAATTGAATGCCAGTTAAACTTTGTCGA
TTTCTGCTGATAGCCAAACTGCAGTTGTTGGAAGTATTCCTGAAATTTTTGAAATCTAAA
AATAATTAATGAAAACAGGAAGAAAAACTGATGAATATAACGGAAAGAGTTATAGCACTT
GGTAGTTTTTGAAAGAATGGATAACTTTTACAGATAGATAGAAATTAGATAAGTATAATG
AATTCGCATCTCATGAATTAAACCTTTTCCTTTACTTCAAAGATAATAATTTCTTTAAAG
TAGTGGTAGAGCCTTTCTTAAAAAATAAAATTTAAAAGTCTTTTATTGACTATTTCCTTC
TTGGTAATAAAGAAGAATAGCTTAAATACTCTAATACTGAAAGGGTCAGCGAGTTAAATA
CCCTTGAATAAGTACTTCTTATCATCACCTTAGTGAAAAATAACTTAAAGTAAAGAGCTG
AATGTTTAGCTTCATCGATTGAAAATACATAAAAGACATAAACTAAAAACATTGATTTGT
AAAAGAGATTATTCCTCACTATCATAGAATCTACAGCAAAAGATGAAATAGTTGTTGCTC
AGCAAGTATTAATGGAGTGTACAAGCTTTAAATCTATGGCGCAAAAGTCTCGTTGTTATG
CAGCAGCACCTATGTAAAAAATGTCTCTCAGATCATCAAAAATGGCAGAATAATCAGATT
TGTTGGATCTTTAATGTGAAGCAGAAGAAGCTGATGACTACTTTGGCGGAGGAGGCTCAA
TGAAGGAGTAACTTATTGAAAAGAGGAAAGAGTTTAAGGAAGGTTATAAAAAGTTAGAAA
ATACTAAAGAATATATTGAAAGACAATATTATTCAGACAATAGAGTAAATAATTATCAAA
ATTTAGTTTAAGTAAACAAATTCTGGAGTGATTTAGCAAGATTTATCGTAAATAATAACG
GGATTGAAAATTTTGTAAGTGAGAATTTTATTTATGGTTTTAATAACCATGTAGAGGCTA
TCAGTGTCCTATCTCTTATGGATATTGCTCATACATCTAGAGACAATTATGACCTTAATT
CTCTTCCAGGAAGGAAAATTCAAATAGTTTCATAAAAGAATGTCATTTACTTCTCAAAAG
AAATTGTTTAATCATCCGATATAACAAAAGTAAATTGAATTTCTTTATTTATCATTTAAA
ATAAAATTTCTTAAAAAATTAATTAAAAAAATTAAAAAATAGTTTTCAATTTAATTTTAT
AATAAAATTATTTTTTAATCTAAATCTAGGCTAATGTTAGCATAATTTAAACTTTCTTTG
ATCCTAATGACAGATTCACAACTCTTAAGGATGATCCTACAGTCAAAATTGAAAAAGAAG
TAGAAGAATTTGTGATTAACAAGATTTATGGATGCAAGGTTATCGTCTCTAACATCTCTA
TAGCTAACTTGAATCTTTCAATACTTACTGAAATTCCTGAAGGAGCTATTCCAGTAAATA
GCTTCGAATATACTAAAAGTATAGACATAACTGTTAACTCTTATCAGACTTACAATAACA
TTGAATTCTTCTTCTATTTCCCTAAGGCTGGTACTTTTAATATTTACAGAAGTAACGCCT
CCAGAAATGGAATTATTATTGCTCAAGCCAATGAAATTGCTCCAATAATTGTCAAGCAAT
TCAATGAAATCAAAAAAATGGAAAATCTTTCTGATATCCTTAATAATGGCTCCAAAGAAG
ACATACTTTAGTTTGCCAAAACCCAAAACTTGCATGACACATAAGCTTTTAACATAAACA
AGATACTCTACATAATATAAAGCGACAAGGTAATTAGATATTTTATTTAACCAAAATTTA
GATTTTTAAAATGTAATAAAAACTTATAATAATAGCATTTCTTCTTGAGTTTCTTAGAGA
TTTTAAGAGAATAGGGAGTGTTTAGCAGGAATGTCTGGGAGTATAGTTTATTCCATAACT
ACGAATAGGGTGTTATAGAATTACTCAACAATCAAGAATTTAGAAAGAACAGAATGATTC
AAATCTACTAAAATGTCCAATCACACAATTCTGACTTACTCAGCTATGATAAATTTTAAG
TTTTCGAGTATCACCCCCTCCTTACATCTCGTACTCACAGCTTTATGAATTAAAATAAGA
GTAAGATCTTGAATGTATAATTCAAGTAAACATACAATGATTATGTCAACTATCTTGCTC
ATGTAGCTCAGCCAACTGTAAATAAAATTATTAAAAAAATTATTTTTATTTATTTATTCA
TGCCTTTATTAAAAATAAGAGCGCCCATTATCTTATTTTGAGCTATTACTTGATTCTTTA
AGAGCGTATAGATGAAGCTTTGTAAGTATTTGGAAAGATCAAAGAGTCAGATTTAACAAA
TAACTCAAAGATTTAATATGACTACTTTGCTGCTTACTTAGATATTTACACAGGTGGTCC
TAACTTCAAGAGAGCCAGAGAAATCAGTTAAGCATATCTCGAATATCCTATTATTTCTTG
GAGAAATCTCTTCGTAAATATTCAAAACTAGCTTACTGAGTATGATGGAGAAGTACTTGA
TGAGTCTGAAGTTGCAGAAAACACTGATCTTAGCAAGGTAATTTTAAACTTAAGAAAATT
TTAATGAATTAATAACAATTAATTTTAAAAGAATTTAAAGAATGCCTAAAAAGAACAGTC
AATGAACTTTGAAATTCAAGAGAAGAAGTTAATAGTTTACTATTAAAATGCTGAAAGAGC
TACTATTAATCTTTATTAACTTGATATTGAAGTCCTATTTTCTACTTAACCTTTCATGGA
AGGAGGAAACAGAAACGAATTTACCTTCATTAAACCCAACCACACAATTAACTTGAATTT
CGAAAAGTTGAGCACCCTTGAAAAGTAAGTAATTGACATTCCAGCTGAATATGCTAATAA
AAATCTTTACATTCAACTTGTTTCCACATCTGGATCCTAAATTCTTTCTTACTTCTCTTC
TTCATTAAAGGTCTAAATGATTGAAAAGTATGGATAAGTAAAAATTCTTGATGAAAAAAA
TGCCCCCTTACAAAAAGTACTTTTTTTTAAATTTATAATAAAAAATAAGCATAATTTATT
CTATAAATAGGTTTATGTTAAGTGCTTTGCTAAATATAAAGATGATTCAGTATAATTCTT
CAGAGATGGTTATACCGACTTGAGAGGAAGATTTGACTATGCTTTAAGCAGTTCTAGTGA
TATTAATTAAGTTAAGCAATTTTCTATTTTAATTTCCAGCGAAGAGCATGGATCAATTAT
CAAAAAAGCCAACCCTCCCACCCAAACTGGAAGTTTTGAGACTGTAAGCTTACTCAAAAA
GAGATGA