Identifiers and Description

Gene Model Identifier

TTHERM_00530680

Standard Name

AIP1 (Asf1-Interacting Protein 1)

Aliases

PreTt04731 | 67.m00246 | 3684.m00116

Description

AIP1 hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00530680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13586.19.997093137033517e-262hypothetical protein (2264 aa)
OxytrichaContig17821.0.g1109.997093137033517e-262hypothetical protein
DictyBaseDDB_G02912296.997420649987812e-71abpF on chromosome: 6 position
145941 to 153138
Stentor CoeruleusSteCoe_152666.375869581278994e-59

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_00530680(coding)
ATGTCAATAGATATTCCCAACTTAGAAAGTTTCCTCTTTACTGAATAAAAGGAAGACTAC
TTAAAGAAATTAGTAGCTGGCACAGATTACTACTACTACTTTACTTTAACCAATGCCCTT
AACTAGTTTGGTCTTGATATACCTTAAGAGTACTAAAGTCTTCTTGAACAATACAAATAG
TTCAACAATAATTAGAGTAAAAGCATTGAATTGAGATATTTACTCTTAAAGTTAGAATCA
GCCAAAACTGAATAAGAAAGAAACACTATCATGAACGATATCAACAAAAAGTATCTACAT
TATGATTTTACCCATACACAACCAACTAGAGCTACTGGTGTGAGTCTTATGGGAGGTTAA
GAATAAACTATCAGTGATTCGCTTGAAAGAGAATTATTATCCTATAAGACATTGCTTAAA
GTTGATAATCTTGAGTACAAGATAAAATCTATTGATGAATATCTGCTTACAGAGCTTGAT
CTTAGCTAATTAGAACACGCTGCTTTTCATGTTTAAGATAGTTTTTTGAATAAAATTAAT
AGCTCCATTAGTGTGATGAAAGGCGTTCCATAATTTCTGAAAAGTTATCACAATAAAAAT
AAAAAGATCCCAGAGTAAATTCTACTTAACTTAACTACTCAGTAATTCAATGAAATAGTA
GCTTTAATTCCAAATATAGTTCTAGATAACGATTTCTTTTAAGCCTACTTGGTTAAATAT
TTCAGATTAGATATTAAAATGGCTGAAAAATTTAATGGCTTATTCGCTTTTGAAAAAATC
GAAGAAAAGAAGAAAATTCTACTTTAAATTCTAGAATTTTTGAGAAAGTTACAATTTAGG
AGACTCAAAATGGAAGATCAAATTTTAAAGGGTCTATTAGTTTTAGGACTTTAAAGCAAT
GAGTATGACTTTGATTTGTTCATCTAATATGTCAAAGAGCCAAGCTTTAACTACATAAAT
TTTAATGAAAAGCACATTAGCATTTATAATTAAAGATAATAACAATTAAGAGTGGATTCT
GATGGATCTTTTTAAGAAGTGTTAACCTTATTTTTTGGTTTAAAAATTGACATCACAGAA
AAATAAATTATTGAGAAGTTTTCAATCAAATACATTTAGCTCAATGAAACATATGACATT
TTAATTCCTTATTTCAGTGAAAAATATTTAAAGAAATAACTTTTAAAGATCCAATTATAA
AAAGGAAAATCTATTGAGAAAATTACAGAAAACTTTACAACTGAAGAAATTAAAGCCATC
ACAGATAAAAAATGCATCAAAATATGCAATTACAATAAATAACTTTTCAGATCAAACGAA
GAAGTTTCTATCGATGTCATTTTGAAGAATATTCCTTAGCTAACTGTTAAGCTATTTGAA
ATAAATACTGAAAACTACTACAAGAAAAACTTAAAAGACCTTGATAACAATGTCGAACTA
GATGGTCTAATAGCTTCAGAAGAAACTTCATTTGAGTTCAAAAATCCTCCTATTCAAAAA
TTCACTCAAACATTCAAATTTGAAAATATCTCTAAAAAAAGCTAAGGCATTTTTGTTATA
GAATTCATAGGAAATGGAGTATCTAGTAGAGCTATAATTAGAAAAGGTTGTTTAGTGTTG
AGACAAAAAAAGACTGTAGCTGGCTTAGCTTGTTAAATATTAGATTAAAATCTATAACTA
TGTGAAGGTCCTAATACTGGAATTTTCTTCTAGAAGAAATATTACCCCTTAAATTCAGAT
AAAGAAGTGATTATTCCTTTTACTGACTCTCAAATAAATGATAAGGCTATTCTAATTCAT
AATGATTTTAGTAGTATTACAGACTTGTAAACTTTGACAGAAGACTATTCATTTTAATGT
GCTTACATTTATAACACTTAATCTATGCTTATGTCTAGTAAAGCTAAAATTCTTATTCAA
CCTCGCTTATACTTCAATAAATAGCCTGCACCTTTAAGTATGCTCAAAGAAAGCAAAATT
ATTGTAACAACTGTAAATTCTATGGGTATACCTTCATCCACTACTTTCAACAAGATTGAA
TTTGAAAGTAAAAGTGAAGTAGAGATAGAATTCCCTGTATCTGCAAAAATAGCAAGTATC
TCTCTTTAAGTTGAAACTACTCTTAAAACAATGACTAAAGGAAATCAAACTTAGAGCAGT
TCTCACATGATTAGCTTCTCAACTCATGAAAATTAGACACATTTTTGCATTTAAAACCTA
CGATACACAACTAGTGGATATGAAATTTACTTAGTTGGCTAAAATGGTGAACCAAAACCT
AATATAAATTTAGATTTATCATTCATATTAAGAGGATATAGCAAATCTATACCTGTTACT
CTTAAAACTAATTCAGATGGTTATGTGAAGCTTTTCGAATTAGAAAATGTATTAAAAATT
ACAAGCAGTGTTAAACAATAAGGCGATATTTTTGCAGAAGATAAAGCATGGTTTATTGAA
AACTCTAATTAAATAAACTATTAATAATTAGTAAAAATTACTCCAAATGATTAAATCAAG
TTACCCTATCATAAAAATGTGCTTGATTCTAATTTAAATTTTGTAAGCACCCTTTCTTAA
ATGGAGGACCGTACTTGTATTTTAAATGATGAAATTCATAGAGTTAAGGTTGAAAATTTT
ACAATTTTGATTGATCCTCTTCCAGTTGGCAACTACAAATTAGTTATTAGAGATATTCCA
GAAGCTATATCAATTGAAGTTGTTGAAGGAAAGTACTGGAATGAAACTCACTGCATACAA
ACTTAAAAAGGGTTGATAGATTAAAAAAGAAATGCCCATTTCCTTGTGATACAAAATGTT
TAAGTTGAAACACCTGATGAAAATTCTACTGGAAATACTTTAAGCATAACGCTATTCACA
GATCATAAAGATTTAGTTAGAGCTCATGTTATAGCTTATCACTATCTTCCTTCTGATATA
AATTCCAGTGTAGACGATTTAAATAAACTTGTAGAGCTTCCTGAGAGCAATTTTATTAAT
TTAACAAAATAATTGAAAGCAAATATTTACCAAAGCAATAAATCAATTGGAGATGAAATT
AGATATGCTCTTGAAAGAAAAAGACATTAAAGATATATAGGAAATACTCTTGACAAGCCT
CATCTTTTGCTTAAAAGAACGTTTGTCCGTGACACAAACTACGAAAATGAATAATTAAAT
AGGGGAGGCACATATTCACCAAGAGCTTCATCAGCAAATCCTTTTGATTAGTTGACAGAA
ATGCTGGAAGGAGGATAAAAATACAAATTAGGAAAAAGTCGTAAAGATGGATCAATAGCT
TATCATCTCTAAAACTAAGTAGATTGTTACAATAATTACTTATTAAATCCAGCTCTAGTT
ATCAGTAATTTGAAACCAGATGAAAATGGCATAATCAAAGTCAAAAACTTAAACTTATCA
AAATACTCCACATTATAAGTTATTGCAACAGACTTGTATAATAATATTACAAAGGTAGTC
CCACTTGATAAAAATGAAATTTAAACAAGAAACTTGTGCTAGAGAGTGAATTAATAAAAG
GATAAGTTCTTTACTATTTCCAGAACAAACGAGTATATTTAAAAGGGTTCTGAATTTAAA
TCTGAAGACTTTACTTCCACTGAACTTTAATTGGTAGATTCTATTCCTAAATTGTTTTCA
GCATAAAAGGAATTAAGAAAAATATATGGAACAGATTCAGAATAAACTAATGGCTACGAC
TTTTGGGAGTTCCTTGTAAAATGGACAACTTTTACTCTAGAAGAAAAGCATAAGAAGTAT
GACTAATACTCATGCCATGAATTAAATCTTTTCATTTTCTGCAAAGACCCTCCCTTCTTT
TAAGACTTTGTTATGCCCTTCATTAAAAATAAAATTGAAAAGACTTTCATAGATTACTTC
TTAATCAACGACTCTAAATACCTTCTAAAAAATATATCTGCCAGCTCAATTTCAGATTTG
AATGCTTTGGAAACTGTACTTTTGATTTTCTTCCTCAAATAAAATAATATGGTGGAAGAA
GCTAAGTCCATTTTTAACTTTTTGGAGAGTTCTAACAAAATTAAGAAGTATGACACTTCG
CACTTTAAGAAGCTATTTGACACTGTTTTAAATGCCAAATAAGAAGGATAAACAGAAAAT
GAAATATAATAGATGTTTATGCCATAAAGTATTTAAGCAAACATCCAATAGTTTACTAAT
AATTTAAATGTAAATTTATTGTAATAGGCTATGCCTATGAACAATGCTTTTGGTGGTGCT
GCTGGTGGTTATTTTGGAGGTATGAATTAAGCATTTCCATAATAAATGTATTAATAATAA
TAATAACACCTTCCTATGATGTAGTGTGCTGCTCCTGCTCCATAAGCAAGGTTTGCAAGA
TAAAATTAAGAAATGAGGAGATTACCACAATAAAATAATTTTGGAGCTCAGAATTATTCA
TATGGTTAATAGGAAGCTTTACATCTACTTGATGATTTTGACGCTGGTTACTAAAATAAG
AGAAATGGGTTTATTTAGCAGTATCAAAATTTAGAGACAACTAAAGAATACTGTGAACGT
CATTATTATTCACAAAAAGAGCTTTAACCTTAAAAAAATTTAGTACCAATCAACAATTTT
TGGATAGATTTAGCAAGACATATAATTACATATGGTTAAGAAAAACCATTCTTGTCTTCT
AATTTTATTTATTGTACATCAAATCACACATAAATGATTACTTCTTTAGCCTTTTTGGCA
CTTCCTTTTGAATCTCAAAGCCATAACTATGAGCCATACGAAGGAAAAGGAATTAAAATA
ACTATGAATTCTAACTGCATCATTTTTGCTAAGTAAATCAAAGAAGGATAAGCTTAGCTT
AGAGAAGACATCTTGATTACTTAAAAGTTCTTTGATCCTAATGATAGATATGTCTTTTCA
GATGAAAATCCAGATGATAAATATGAAAAGTAAATAACAGAGTATGTAGTTGATAAGAGA
TATGGATGTTAAGTTATTGTAACAAATTGTTCAGCTGCAAGACATGAGCTTCAGGTCTTT
GTAGAAATTCCCTCTGGTTCAATTCCTGTCTTCACTTCTGATTACACTAAAACACACAAT
ATCATTCTTGAGCCATTCTAAACTAAGCCTATTGAATACTTTTTCTATTTCCCTTAGGCT
GGCAATCAAGATATTTATCCAGCAAACGTAGCAAAGAGTGGATAAATTGTAGCTTTTGCC
AAACCTTGTACTTTTGATGTTAAAGAAAAGAGGACAGTCTCAAATCTGGAAACAATGAAT
GAAATCCTTTAAAAGGGTTCAAAAGAAGATATTTTGAAGTTTGTTTAAACTAAAAATATA
CTTAACACTAATATTTTCTAATTTAATGAGATTTACTATCTATTGAAAGACAAGTCTTTC
TATCAAAAATTCGTAGAAATATTAAAAAATAGAAAGGTCTTTGATACGATTACTTGGGCT
TACTCTATTTATCATGGAGATTATAGCACCTTCTTAGAATTAATTAAGTCTCCTTCTATA
TCTACCTCATTTGAAAGCTATCTCTATTATTTCAATACAAATTCTTTAACTATTGATAAG
AATAGATTCTACGAATATTACCCTTTATCTAACCCTCGTGTCCATATGCTCCACTCTGAT
AAAGTAATTTTAATTTTTATATTTAAATATTGA


>TTHERM_00530680(protein)
MSIDIPNLESFLFTEQKEDYLKKLVAGTDYYYYFTLTNALNQFGLDIPQEYQSLLEQYKQ
FNNNQSKSIELRYLLLKLESAKTEQERNTIMNDINKKYLHYDFTHTQPTRATGVSLMGGQ
EQTISDSLERELLSYKTLLKVDNLEYKIKSIDEYLLTELDLSQLEHAAFHVQDSFLNKIN
SSISVMKGVPQFLKSYHNKNKKIPEQILLNLTTQQFNEIVALIPNIVLDNDFFQAYLVKY
FRLDIKMAEKFNGLFAFEKIEEKKKILLQILEFLRKLQFRRLKMEDQILKGLLVLGLQSN
EYDFDLFIQYVKEPSFNYINFNEKHISIYNQRQQQLRVDSDGSFQEVLTLFFGLKIDITE
KQIIEKFSIKYIQLNETYDILIPYFSEKYLKKQLLKIQLQKGKSIEKITENFTTEEIKAI
TDKKCIKICNYNKQLFRSNEEVSIDVILKNIPQLTVKLFEINTENYYKKNLKDLDNNVEL
DGLIASEETSFEFKNPPIQKFTQTFKFENISKKSQGIFVIEFIGNGVSSRAIIRKGCLVL
RQKKTVAGLACQILDQNLQLCEGPNTGIFFQKKYYPLNSDKEVIIPFTDSQINDKAILIH
NDFSSITDLQTLTEDYSFQCAYIYNTQSMLMSSKAKILIQPRLYFNKQPAPLSMLKESKI
IVTTVNSMGIPSSTTFNKIEFESKSEVEIEFPVSAKIASISLQVETTLKTMTKGNQTQSS
SHMISFSTHENQTHFCIQNLRYTTSGYEIYLVGQNGEPKPNINLDLSFILRGYSKSIPVT
LKTNSDGYVKLFELENVLKITSSVKQQGDIFAEDKAWFIENSNQINYQQLVKITPNDQIK
LPYHKNVLDSNLNFVSTLSQMEDRTCILNDEIHRVKVENFTILIDPLPVGNYKLVIRDIP
EAISIEVVEGKYWNETHCIQTQKGLIDQKRNAHFLVIQNVQVETPDENSTGNTLSITLFT
DHKDLVRAHVIAYHYLPSDINSSVDDLNKLVELPESNFINLTKQLKANIYQSNKSIGDEI
RYALERKRHQRYIGNTLDKPHLLLKRTFVRDTNYENEQLNRGGTYSPRASSANPFDQLTE
MLEGGQKYKLGKSRKDGSIAYHLQNQVDCYNNYLLNPALVISNLKPDENGIIKVKNLNLS
KYSTLQVIATDLYNNITKVVPLDKNEIQTRNLCQRVNQQKDKFFTISRTNEYIQKGSEFK
SEDFTSTELQLVDSIPKLFSAQKELRKIYGTDSEQTNGYDFWEFLVKWTTFTLEEKHKKY
DQYSCHELNLFIFCKDPPFFQDFVMPFIKNKIEKTFIDYFLINDSKYLLKNISASSISDL
NALETVLLIFFLKQNNMVEEAKSIFNFLESSNKIKKYDTSHFKKLFDTVLNAKQEGQTEN
EIQQMFMPQSIQANIQQFTNNLNVNLLQQAMPMNNAFGGAAGGYFGGMNQAFPQQMYQQQ
QQHLPMMQCAAPAPQARFARQNQEMRRLPQQNNFGAQNYSYGQQEALHLLDDFDAGYQNK
RNGFIQQYQNLETTKEYCERHYYSQKELQPQKNLVPINNFWIDLARHIITYGQEKPFLSS
NFIYCTSNHTQMITSLAFLALPFESQSHNYEPYEGKGIKITMNSNCIIFAKQIKEGQAQL
REDILITQKFFDPNDRYVFSDENPDDKYEKQITEYVVDKRYGCQVIVTNCSAARHELQVF
VEIPSGSIPVFTSDYTKTHNIILEPFQTKPIEYFFYFPQAGNQDIYPANVAKSGQIVAFA
KPCTFDVKEKRTVSNLETMNEILQKGSKEDILKFVQTKNILNTNIFQFNEIYYLLKDKSF
YQKFVEILKNRKVFDTITWAYSIYHGDYSTFLELIKSPSISTSFESYLYYFNTNSLTIDK
NRFYEYYPLSNPRVHMLHSDKVILIFIFKY


>TTHERM_00530680(gene)
ATGTCAATAGATATTCCCAACTTAGAAAGTTTCCTCTTTACTGAATAAAAGGAAGACTAC
TTAAAGAAATTAGTAGCTGGCACAGATTACTACTACTACTTTACTTTAACCAATGCCCTT
AACTAGTTTGGTCTTGATATACCTTAAGAGTACTAAAGTCTTCTTGAACAATACAAATAG
TTCAACAATAATTAGAGTAAAAGCATTGAATTGAGATATTTACTCTTAAAGTTAGAATCA
GCCAAAACTGAATAAGAAAGAAACACTGTAAGATAAATCATTTTATTTAAATTAAAATAT
TCTAATTTTTTAAATTGTTTAGATCATGAACGATATCAACAAAAAGTATCTACATTATGA
TTTTACCCATACACAACCAACTAGAGCTACTGGTGTGAGTCTTATGGGAGGTTAAGAATA
AACTATCAGTGATTCGCTTGAAAGAGAATTATTATCCTATAAGACATTGCTTAAAGTTGA
TAATCTTGAGTACAAGATAAAATCTATTGATGAATATCTGCTTACAGAGCTTGATCTTAG
CTAATTAGAACACGCTGCTTTTCATGTTTAAGATAGTTTTTTGAATAAAATTAATAGCTC
CATTAGTGTGATGAAAGGCGTTCCATAATTTCTGAAAAGTTATCACAATAAAGTACTATT
TTTTTTATCTTAATTTGTTTTATTAAAAAAATATTTTAATATTAGAATAAAAAGATCCCA
GAGTAAATTCTACTTAACTTAACTACTCAGTAATTCAATGAAATAGTAGCTTTAATTCCA
AATATAGTTCTAGATAACGATTTCTTTTAAGCCTACTTGGTTAAATATTTCAGATTAGAT
ATTAAAATGGCTGAAAAATTTAATGGCTTATTCGCTTTTGAAAAAATCGAAGAAAAGAAG
AAAATTCTACTTTAAATTCTAGAATTTTTGAGAAAGTTACAATTTAGGAGACTCAAAATG
GAAGATCAAATTTTAAAGGGTCTATTAGTTTTAGGACTTTAAAGCAATGAGTATGACTTT
GATTTGTTCATCTAATATGTCAAAGAGCCAAGCTTTAACTACATAAATTTTAATGAAAAG
CACATTAGCATTTATAATTAAAGATAATAACAATTAAGAGTGGATTCTGATGGATCTTTT
TAAGAAGTGTTAACCTTATTTTTTGGTTTAAAAATTGACATCACAGAAAAATAAATTATT
GAGAAGTTTTCAATCAAATACATTTAGCTCAATGAAACATATGACATTTTAATTCCTTAT
TTCAGTGAAAAATATTTAAAGAAATAACTTTTAAAGATCCAATTATAAAAAGGAAAATCT
ATTGAGAAAATTACAGAAAACTTTACAACTGAAGAAATTAAAGCCATCACAGATAAAAAA
TGCATCAAAATATGCAATTACAATAAAGTAAATTTTGTTAGATTTTTTATTTGCTCAAGC
TCAAATTAAATTTTGCAAAAAACAATATTTAATCTACAATTTTTTATTTTAATAATTTAA
TTAATTAAAAGTAACTTTTCAGATCAAACGAAGAAGTTTCTATCGATGTCATTTTGAAGA
ATATTCCTTAGCTAACTGTTAAGCTATTTGAAATAAATACTGAAAACTACTACAAGAAAA
ACTTAAAAGACCTTGATAACAATGTCGAACTAGATGGTCTAATAGCTTCAGAAGAAACTT
CATTTGAGTTCAAAAATCCTCCTATTCAAAAATTCACTCAAACATTCAAATTTGAAAATA
TCTCTAAAAAAAGCTAAGGCATTTTTGTTATAGAATTCATAGGAAATGGAGTATCTAGTA
GAGCTATAATTAGAAAAGGTTGTTTAGTGTTGAGACAAAAAAAGACTGTAGCTGGCTTAG
CTTGTTAAATATTAGATTAAAATCTATAACTATGTGAAGGTCCTAATACTGGAATTTTCT
TCTAGAAGAAATATTACCCCTTAAATTCAGATAAAGAAGTGATTATTCCTTTTACTGACT
CTCAAATAAATGATAAGGCTATTCTAGTAATTATAATTAAATTATTAAATAATATTATTA
ATTAACCCTTTTAACTAATTAGATTCATAATGATTTTAGTAGTATTACAGACTTGTAAAC
TTTGACAGAAGTAATTATATTATCAATATATTTATATAAAATTTAAACTTATTTTAATTT
AATGAAAAATATATTTATTAAAAAATTAGGACTATTCATTTTAATGTGCTTACATTTATA
ACACTTAATCTATGCTTATGTCTAGTAAAGCTAAAATTCTTATTCAACCTCGCTTATACT
TCAATAAATAGCCTGCACCTTTAAGTATGCTCAAAGAAAGCAAAATTATTGTAACAACTG
TAAATTCTATGGGTATACCTTCATCCACTACTTTCAACAAGATTGAATTTGAAAGTAAAA
GTGAAGTAGAGATAGAATTCCCTGTATCTGCAAAAATAGCAAGTATCTCTCTTTAAGTTG
AAACTACTCTTAAAACAATGACTAAAGGAAATCAAACTTAGAGCAGTTCTCACATGATTA
GCTTCTCAACTCATGAAAGTAAATAGTTAATTTTCATTTAAATTCAAATAAAGAAATCAT
TTTATTAAAATATATAGATTAGACACATTTTTGCATTTAAAACCTACGATACACAACTAG
TGGATATGAAATTTACTTAGTTGGCTAAAATGGTGAACCAAAACCTAATATAAATTTAGA
TTTATCATTCATATTAAGAGGATATAGCAAATCTATACCTGTTACTCTTAAAACTAATTC
AGATGGTTATGTGAAGCTTTTCGAATTAGAAAATGTATTAAAAATTACAAGCAGTGTTAA
ACAATAAGGCGATATTTTTGCAGAAGATAAAGCATGGTTTATTGAAAACTCTAATTAAAT
AAACTATTAATAATTAGTAAAAATTACTCCAAATGATTAAATCAAGTTACCCTATCATAA
AAATGTGCTTGATTCTAATTTAAATTTTGTAAGCACCCTTTCTTAAATGGAGGACCGTAC
TTGTATTTTAAATGATGAAATTCATAGAGTTAAGGTTGAAAATTTTACAATTTTGATTGA
TCCTCTTCCAGTTGGCAACTACAAATTAGTTATTAGAGATATTCCAGAAGCTATATCAAT
TGAAGTTGTTGAAGGTAAATCTTTTTTCTTACTTAAGATACTCAACTAAAATTCTTTTTT
TTAATTATAAATTAGGAAAGTACTGGAATGAAACTCACTGCATACAAACTTAAAAAGGGT
TGATAGATTAAAAAAGAAATGCCCATTTCCTTGTGATACAAAATGTTTAAGTTGAAACAC
CTGATGAAAATTCTACTGGAAATACTTTAAGCATAACGCTATTCACAGATCATAAAGATT
TAGTTAGAGCTCATGTTATAGCTTATCACTATCTTCCTTCTGATATAAATTCCAGTGTAG
ACGATTTAAATAAACTTGTAGAGCTTCCTGAGAGCAATTTTATTAATTTAACAAAATAAT
TGAAAGCAAATATTTACCAAAGCAATAAATCAATTGGAGATGAAATTAGATATGCTCTTG
AAAGAAAAAGACATTAAAGATATATAGGAAATACTCTTGACAAGCCTCATCTTTTGCTTA
AAAGAACGTTTGTCCGTGACACAAACTACGAAAATGAATAATTAAATAGGGGAGGCACAT
ATTCACCAAGAGCTTCATCAGCAAATCCTTTTGATTAGTTGACAGAAATGCTGGAAGGAG
GATAAAAATACAAATTAGGAAAAAGTCGTAAAGATGGATCAATAGCTTATCATCTCTAAA
ACTAAGTAGATTGTTACAATAATTACTTATTAAATCCAGCTCTAGTTATCAGTAATTTGA
AACCAGATGAAAATGGCATAATCAAAGTCAAAAACTTAAACTTATCAAAATACTCCACAT
TATAAGTTATTGCAACAGACTTGTATAATAGTAATATTTTATTTTTATTTTTTAAACAAA
ACTAATAAATTATTTTCCTAAAAAAAGATATTACAAAGGTAGTCCCACTTGATAAAAATG
AAATTTAAACAAGAAACTTGTGCTAGAGAGTGAATTAATAAAAGGATAAGTTCTTTACTA
TTTCCAGAACAAACGAGTATATTTAAAAGGGTTCTGAATTTAAATCTGAAGACTTTACTT
CCACTGAACTTTAATTGGTAGATTCTATTCCTAAATTGTTTTCAGCATAAAAGGAATTAA
GAAAAATATATGGAACAGATTCAGAATAAACTAATGGCTACGACTTTTGGGAGTTCCTTG
TAAAATGGACAACTTTTACTCTAGAAGAAAAGCATAAGAAGTATGACTAATACTCATGCC
ATGAATTAAATCTTTTCATTTTCTGCAAAGACCCTCCCTTCTTTTAAGACTTTGTTATGC
CCTTCATTAAAAATAAAATTGAAAAGACTTTCATAGATTACTTCTTAATCAACGACTCTA
AATACCTTCTAAAAAATATATCTGCCAGCTCAATTTCAGATTTGAATGCTTTGGAAACTG
TACTTTTGATTTTCTTCCTCAAATAAAATAATATGGTGGAAGAAGCTAAGTCCATTTTTA
ACTTTTTGGAGAGTTCTAACAAAATTAAGAAGTATGACACTTCGCACTTTAAGAAGCTAT
TTGACACTGTTTTAAATGCCAAATAAGAAGGATAAACAGAAAATGAAATATAATAGATGT
TTATGCCATAAAGTATTTAAGCAAACATCCAATAGTTTACTAATAATTTAAATGTAAATT
TATTGTAATAGGCTATGCCTATGAACAATGCTTTTGGTGGTGCTGCTGGTGGTTATTTTG
GAGGTATGAATTAAGCATTTCCATAATAAATGTATTAATAATAATAATAACACCTTCCTA
TGATGTAGTGTGCTGCTCCTGCTCCATAAGCAAGGTTTGCAAGATAAAATTAAGAAATGA
GGAGATTACCACAATAAAATAATTTTGGAGCTCAGAATTATTCATATGGTTAATAGGAAG
CTTTACATCTACTTGATGATTTTGACGCTGGTTACTAAAATAAGAGAAATGGGTTTATTT
AGCAGTATCAAAATTTAGAGACAACTAAAGAATACTGTGAACGTCATTATTATTCACAAA
AAGAGCTTTAACCTTAAAAAAATTTAGTACCAATCAACAATTTTTGGATAGATTTAGCAA
GACATATAATTACATATGGTTAAGAAAAACCATTCTTGTCTTCTAATTTTATTTATTGTA
CATCAAATCACACATAAATGATTACTTCTTTAGCCTTTTTGGCACTTCCTTTTGAATCTC
AAAGCCATAACTATGAGCCATACGAAGGAAAAGGAATTAAAATAACTATGAATTCTAACT
GCATCATTTTTGCTAAGTAAATCAAAGAAGGATAAGCTTAGCTTAGAGAAGACATCTTGA
TTACTTAAAAGTTCTTTGATCCTAATGATAGATATGTCTTTTCAGATGAAAATCCAGATG
ATAAATATGAAAAGTAAATAACAGAGTATGTAGTTGATAAGAGATATGGATGTTAAGTAA
TACTAATAAATTAGATATAGATTTAACTTATTTTTTTATCATTAAATATATTAGGTTATT
GTAACAAATTGTTCAGCTGCAAGACATGAGCTTCAGGTCTTTGTAGAAATTCCCTCTGGT
TCAATTCCTGTCTTCACTTCTGATTACACTAAAACACACAATATCATTCTTGAGCCATTC
TAAACTAAGCCTATTGAATACTTTTTCTATTTCCCTTAGGTAACTTATTTATTTATTAAT
TATTTATTTATAAAATTATAAAATATTTGCTATTAAAAAAATAGGCTGGCAATCAAGATA
TTTATCCAGCAAACGTAGCAAAGAGTGGATAAATTGTAGCTTTTGCCAAACCTTGTACTT
TTGATGTTAAAGAAAAGAGGACAGTCTCAAATCTGGAAACAATGAATGAAATCCTTTAAA
AGGGTTCAAAAGAAGATATTTTGAAGTTTGTTTAAACTAAAAATATACTTAACACTAATA
TTTTCTAATTTAATGAGATTTACTATCTATTGAAAGACAAGTCTTTCTATCAAAAATTCG
TAGAAATATTAAAAAATAGAAAGGTCTTTGATACGATTACTTGGGCTTACTCTATTTATC
ATGGAGATTATAGCACCTTCTTAGAATTAATTAAGTCTCCTTCTATATCTACCTCATTTG
AAAGCTATCTCTATTATTTCAATACAAATTCTTTAACTATTGATAAGAATAGATTCTACG
AATATTACCCTTTATCTAACCCTCGTGTCCATATGCTCCACTCTGATAAAGTAATTTTAA
TTTTTATATTTAAATATTGA