Identifiers and Description

Gene Model Identifier

TTHERM_00088010

Standard Name

AFA1 (AAA Family ATPase 1)

Aliases

PreTt16451 | 6.m00525 | 3836.m02117 | QUEENB1

Description

ATPase, AAA family protein; localizes to micronucleus during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF00004 ) ATPase, AAA family
  • ( TIGR03263 ) guanylate kinase
  • ( PF00158 ) Sigma-54 interaction domain
  • ( TIGR02881 ) stage V sporulation protein K
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR00635 ) Holliday junction DNA helicase RuvB
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( PF09336 ) Vps4 C terminal oligomerisation domain
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00088010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02490.19.997093137033517e-262ATPase, AAA family protein (74
6 aa)
OxytrichaContig1478.1.g581.9996385480812013e-123ATPase family associated with
various cellular activities (A
AA)
DictyBaseDDB_G02683347.998584418911683e-103DDB_G0268334 on chromosome: 1
position 714031 to 716367
WormBaseWBGene000179813.0006488705143073e-92locus:figl-1 Fidgetin-like p
rotein 1 status:Partially_co
nfirmed UniProt:O16299 pro
tein_id:CCD68481.1
SGDYPL074W7.998415523157811e-91YTA6 Putative ATPase of the CD
C48/PAS1/SEC18 (AAA) family, l
ocalized to the cortex of moth
er cells but not to daughter c
ells
Stentor CoeruleusSteCoe_152734.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000209
  2. Ref:SUPR000347

Sequences

>TTHERM_00088010(coding)
ATGCTTTCTACTTATAAAGATGCTGGGGATGGGGGATTGTAATAAGATAATTTAATTCCA
ATGTAGAAGGAAACCCTTAAGAGTATTTTATCCAGCTTTAAAAATAAGATGAATGAGACT
CATTAATTGTATTCTTAAAATTCAAACTCTCTTCAAAAAGAAGATAAAGAAGATGTATAT
AAACATGCTTTTTCTTTCGCTTTTCTACTTTAAAAGTATTAAGAGAAAGACAACTCACTA
TGTTTAGAAGATTTTATTTAAGAAGCTGAACGAATGAGAGATCATCAGTTATACAAACCA
AGCAAGGCTAATAAAAAGTTTAATATAATGCCAAAAATATCTAAAGAAAAGTTTGAGTAA
TTTATAGAATATGAAAAAGATACAAGATTTCCTCAACCTAGAAAAACAGTACAGTTAAAT
ACTCAAGCAAGACTTCCAGAAAGACAAACATCAAATTAAAAGCCTGCAATAAGTAGTTTA
TTGAATAGCAATAATAATTAAATCTCATCCAACTCTAATTAAGGATATGGGAATATAAAT
AGTTTTTAGAACAATCCTAATAATAGTATTGATAATAATAAAAATAATAATAATAATTTT
GGTCCTACTTAACAAAATAATAACAATGGGTTTTATAGATCTCAAAGCAGTTAAAATTAA
GATGAACAACCATAAAAAACAAATGGATATAAATAATAGTATAACAATGGCTACAACAGC
TATTAAAATTAAAATACAAATAATTTTGGGTATGGTAGAAATAGGTATCAAAATAACAAT
AGATATAATAAAGGAAGGGAGTAAATTGAAGAAGAATAAGATGAGTAATAGTAAGCTGGA
GGTTTTAAAACAGCATCAGAATAAAGATATTAAAATAATATGTTAAAGAGATAAAAAGAA
GAAGGATTCTATAATAAAGAAACTGGAAAATATGGTAGAAATAATGGATAGCTAGAGTTT
GAAGGTGTGAATGATAATAAACCTAAATACGGATATACAAAATATGGAAGTAACTAGGGA
GTTGATGATGTTGTTAATCTTGTCCATTACCATACTATAGGGAAAAACCTCAATTTAAAT
AATAATTCTTCATCTAATTAAGCTGCTGCCTTAAATGGAGGTGGTACAGAAGACGAATAT
AAAAAGACAGGACTAAGCAGAAAATTCAAACCTCCAGGAGCACCTGGTTCAAATACCGGA
GGGAAAAAAAATGAATAGTGTGAGCAGCTCAAAGGAATGGATTAAAAATTAATAGATTTA
ATTGAAAACGAAATTGTAGAAAATGCTGCTAATGTTAAGTGGGAAGATATAGCTGGTTTA
AGTTCAGCTAAGGAATCTGTCAAGGAAACTATAGTTTGGCCTATGTTGAACCCATAAATC
TTTACTGGTATTAGAGCTCCTCCTAAAGGTCTTCTCTTGTTTGGACCACCTGGAACAGGT
AAGACTATGATTGGCAAGGCTATTGCTAATCAATCTGGCTCTACATTTTTTTCTATATCA
GCATCTTCTCTAACAAGTAAATATATTGGTGAAGGTGAGAAAATGGTAAAAATTCTCTTC
AAGCTAGCAGAAATGAGATAACCAAGTGTTATTTTTATTGATGAAATAGACTCACTTTTA
TGTGCAAGATAAGAAAATGAAAATGAGGCAAGTAGAAGAATTAAGACAGAGTTTTTAGTT
TAAATGGAAGGTGCTACTTCAAGAGAAGAAGTAAGATTGTTACTTATAGGAGCAACAAAT
AGGCCATAAGAACTTGATGATGCTGTTAGAAGAAGATTTGTTAAGAAATTATATATTCCT
CTACCTAATATGGTAGCAAGAGAGTAATTGATAAGAAGAGTAATTGAAAGAGAATCAGCA
AAAGGAAACGCTTTTGATATGAGCGACCAAGATATTTTAGAAGTTGTTCAAGCTACAAAA
GGTTTTTCTGGAGCTGATATGACAAACCTTTGTAAGGAGGCAGCTTTAATACCTATCCGT
CAATGTACTGATATAACAAACATATAGTCTAGTGATATTCGTCCTATCAATAAATCAGAT
TTTGTAAAGTCACTAAAATAAGTTAAAGCTACAGTAACTTCAAAAGATTTAGCTGGATAT
TTTGATTGGAATAACTAATTTGGTAGTTTTGAAATAAATATGGAAGAAATAGATTCCTGA


>TTHERM_00088010(protein)
MLSTYKDAGDGGLQQDNLIPMQKETLKSILSSFKNKMNETHQLYSQNSNSLQKEDKEDVY
KHAFSFAFLLQKYQEKDNSLCLEDFIQEAERMRDHQLYKPSKANKKFNIMPKISKEKFEQ
FIEYEKDTRFPQPRKTVQLNTQARLPERQTSNQKPAISSLLNSNNNQISSNSNQGYGNIN
SFQNNPNNSIDNNKNNNNNFGPTQQNNNNGFYRSQSSQNQDEQPQKTNGYKQQYNNGYNS
YQNQNTNNFGYGRNRYQNNNRYNKGREQIEEEQDEQQQAGGFKTASEQRYQNNMLKRQKE
EGFYNKETGKYGRNNGQLEFEGVNDNKPKYGYTKYGSNQGVDDVVNLVHYHTIGKNLNLN
NNSSSNQAAALNGGGTEDEYKKTGLSRKFKPPGAPGSNTGGKKNEQCEQLKGMDQKLIDL
IENEIVENAANVKWEDIAGLSSAKESVKETIVWPMLNPQIFTGIRAPPKGLLLFGPPGTG
KTMIGKAIANQSGSTFFSISASSLTSKYIGEGEKMVKILFKLAEMRQPSVIFIDEIDSLL
CARQENENEASRRIKTEFLVQMEGATSREEVRLLLIGATNRPQELDDAVRRRFVKKLYIP
LPNMVAREQLIRRVIERESAKGNAFDMSDQDILEVVQATKGFSGADMTNLCKEAALIPIR
QCTDITNIQSSDIRPINKSDFVKSLKQVKATVTSKDLAGYFDWNNQFGSFEINMEEIDS


>TTHERM_00088010(gene)
ATGCTTTCTACTTATAAAGATGCTGGGGATGGGGGATTGTAATAAGATAATTTAATTCCA
ATGTAGAAGGAAACCCTTAAGAGTATTTTATCCAGCTTTAAAAATAAGATGAATGAGACT
CATTAATTGTATTCTTAAAATTCAAACTCTCTTCAAAAAGAAGATAAAGAAGATGTATAT
AAACATGCTTTTTCTTTCGCTTTTCTACTTTAAAAGTATTAAGAGAAAGACAACTCACTA
TGTTTAGAAGATTTTATTTAAGAAGCTGAACGAATGAGAGATCATCAGTTATACAAACCA
AGCAAGGCTAATAAAAAGTTTAATATAATGCCAAAAATATCTAAAGAAAAGTTTGAGTAA
TTTATAGAATATGAAAAAGATACAAGATTTCCTCAACCTAGAAAAACAGTACAGTTAAAT
ACTCAAGCAAGACTTCCAGAAAGACAAACATCAAATTAAAAGCCTGCAATAAGTAGTTTA
TTGAATAGCAATAATAATTAAATCTCATCCAACTCTAATTAAGGATATGGGAATATAAAT
AGTTTTTAGAACAATCCTAATAATAGTATTGATAATAATAAAAATAATAATAATAATTTT
GGTCCTACTTAACAAAATAATAACAATGGGTTTTATAGATCTCAAAGCAGTTAAAATTAA
GATGAACAACCATAAAAAACAAATGGATATAAATAATAGTATAACAATGGCTACAACAGC
TATTAAAATTAAAATACAAATAATTTTGGGTATGGTAGAAATAGGTATCAAAATAACAAT
AGATATAATAAAGGAAGGGAGTAAATTGAAGAAGAATAAGATGAGTAATAGTAAGCTGGA
GGTTTTAAAACAGCATCAGAATAAAGATATTAAAATAATATGTTAAAGAGATAAAAAGAA
GAAGGATTCTATAATAAAGAAACTGGAAAATATGGTAGAAATAATGGATAGCTAGAGTTT
GAAGGTGTGAATGATAATAAACCTAAATACGGATATACAAAATATGGAAGTAACTAGGGA
GTTGATGATGTTGTTAATCTTGTCCATTACCATACTATAGGGAAAAACCTCAATTTAAAT
AATAATTCTTCATCTAATTAAGCTGCTGCCTTAAATGGAGGTGGTACAGAAGACGAATAT
AAAAAGACAGGACTAAGCAGAAAATTCAAACCTCCAGGAGCACCTGGTTCAAATACCGGA
GGGAAAAAAAATGAATAGTGTGAGCAGCTCAAAGGAATGGATTAAAAAGTAAAATTTATT
AAAACAGATTTTAGTTATTAAAAATTTTTTTCATAAAGTTAATAGATTTAATTGAAAACG
AAATTGTAGAAAATGCTGCTAATGTTAAGTGGGAAGATATAGCTGGTTTAAGTTCAGCTA
AGGAATCTGTCAAGGAAACTATAGTTTGGCCTATGTTGAACCCATAAATCTTTACTGGTA
TTAGAGCTCCTCCTAAAGTAAAAAACATTTTAAATTTAATAGTTAATTTAATATTTAATT
ATAGGGTCTTCTCTTGTTTGGACCACCTGGAACAGGTAAGACTATGATTGGCAAGGCTAT
TGCTAATCAATCTGGCTCTACATTTTTTTCTATATCAGCATCTTCTCTAACAAGTAAATA
TATTGGTGAAGGTGAGAAAATGGTAAAAATTCTCTTCAAGCTAGCAGAAATGAGATAACC
AAGTGTTATTTTTATTGATGAAATAGACTCACTTTTATGTGCAAGATAAGAAGTAAAATA
AATAATAATAAAATTAAATATAAATTTATTTTAGCCTAATTGCTAAAATTTAAGATAAAA
CAAAAAATTATTTACAAATTTAAAATTTTTAGAATGAAAATGAGGCAAGTAGAAGAATTA
AGACAGAGTTTTTAGTTTAAATGGAAGGTGCTACTTCAAGAGAAGAAGTAAGATTGTTAC
TTATAGGAGCAACAAATAGGCCATAAGAACTTGATGATGTGATTAATTTTCAAAATTTTG
GATTTCATAATCTAATTTATTTTATTAATAGGCTGTTAGAAGAAGATTTGTTAAGAAATT
ATATATTCCTCTACCTAATATGGTAGCAAGAGAGTAATTGATAAGAAGAGTAATTGAAAG
AGAATCAGCAAAAGGAAACGCTTTTGATATGAGCGACCAAGTAAAAAATTAATTGCATAT
AAGAAATACTAAGAAGATAAATTATTCATTTTTAATTTTAAAAATTTATAATAAATAGGA
TATTTTAGAAGTTGTTCAAGCTACAAAAGGTTTTTCTGGAGCTGATATGACAAACCTTTG
TAAGGAGGCAGCTTTAATACCTATCCGTCAATGTACTGATATAACAAACATATAGTCTAG
TGATATTCGTCCTATCAATAAATCAGATTTTGTAAAGTCACTAAAATAAGTTAAAGCTAC
AGTAACTTCAAAAGATTTAGCTGGATATTTTGATTGGAATAACTAATTTGGTAGTTTTGA
AATAAATATGGAAGAAATAGATTCCTGA