Identifiers and Description

Gene Model Identifier

TTHERM_00794150

Standard Name

ADF73 (actin-depolymerizing factor)

Aliases

PreTt21414 | 134.m00094

Description

Cofilin/tropomyosin-type actin binding protein; principle actin-modulating protein involved in membrane deformations (including phagocytosis, but not cytokinesis) by severing and depolymerizing F-actin.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00241 ) Cofilin/tropomyosin-type actin-binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00794150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13290.13.0013199058937152e-77cofilin/tropomyosin-type actin
-binding protein (136 aa)
OxytrichaContig8853.0.g811.999790113608142e-24Cofilin/tropomyosin-type actin
-binding protein
SGDYLL050C2.000620012690291e-23COF1 Cofilin, promotes actin f
ilament depolarization in a pH
-dependent manner; binds both
actin monomers and filaments a
nd severs filaments; thought t
o be regulated by phosphorylat
ion at SER4; ubiquitous and es
sential in eukaryotes
DictyBaseDDB_G02919704.997543945741262e-17cofB on chromosome: 6 position
1044327 to 1044740
WormBaseWBGene000067940.00000000002000577768187062locus:unc-60 Actin-depolymer
izing factor 2, isoform c st
atus:Partially_confirmed Uni
Prot:Q07749 protein_id:CCD67
023.1
Stentor CoeruleusSteCoe_113590.000000002061153622438558

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23729382: Shiozaki N, Nakano K, Kushida Y, Noguchi TQ, Uyeda TQ, Wloga D, Dave D, Vasudevan KK, Gaertig J, Numata O (2013) ADF/cofilin is not essential but is critically important for actin activities during phagocytosis in Tetrahymena thermophila. Eukaryotic cell 12(8):1080-6
  2. Ref:19769938: Shiozaki N, Nakano K, Takaine M, Abe H, Numata O (2009) Usual and unusual biochemical properties of ADF/cofilin-like protein Adf73p in ciliate Tetrahymena thermophila. Biochemical and biophysical research communications 390(1):54-9
  3. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00794150(coding)
ATGGATATCGGCTTACAAGTTGCTGACGACTGTCTCTAATAATTCCAAGCCATGAAGATG
GAAAAGAAACATCGTTATATTATTTTTCACACTAAGAATAACAAGACCATTGAAATTGAA
AAGATTGGAGCTAGAGATGAAACCTACTAACAATTTGTTGACAGTCTCCCACAAAATGAT
GCTCGTTTCTGCGTTTTTGATTATGATAAGAAATTCGATGATGGCAGAGTCACCTCTAAG
ATTATCTATTTCTTCTGGTGTCCTGATACTGCCCCAGTCAAGGTCAAGATGGTCTCTGCT
ACTACCAATTCATTCTTCTAAAATAAAATCTAAGGTTTCGCTATCAACCTCTAATGCAAT
GATTTAGGTTCTTTCGATACCGAAGAACTCGAAAAGAAGATCCATTGA


>TTHERM_00794150(protein)
MDIGLQVADDCLQQFQAMKMEKKHRYIIFHTKNNKTIEIEKIGARDETYQQFVDSLPQND
ARFCVFDYDKKFDDGRVTSKIIYFFWCPDTAPVKVKMVSATTNSFFQNKIQGFAINLQCN
DLGSFDTEELEKKIH


>TTHERM_00794150(gene)
ATGGATATCGGCTTACAAGTTGCTGACGACTGTCTCTAATAATTCCAAGCCATGAAGATG
GAAAAGAAACATCGTTATATTATTTTTCACACTAAGAATAACAAGACCATTGAAATTGAA
AAGATTGGAGCTAGAGATGAAACCTACTAACAATTTGTTGACAGTCTCCCACAAAATGAT
GCTCGTTTCTGCGTTTTTGATTATGATAAGAAATTCGATGATGGCAGAGTCACCTCTAAG
ATTATCTATTTCTTCTGGTGTCCTGATACTGCCCCAGTCAAGGTCAAGATGGTCTCTGCT
ACTACCAATTCATTCTTCTAAAATAAAATCTAAGGTTTCGCTATCAACCTCTAATGCAAT
GATTTAGGTTCTTTCGATACCGAAGAACTCGAAAAGAAGATCCATTGA