Identifiers and Description

Gene Model Identifier

TTHERM_00790730

Standard Name

ADA2 (transcriptional ADAptor 2)

Aliases

PreTt01363 | 133.m00088

Description

Myb-like DNA-binding domain protein; Member of the SAGA complex. Myb-like DNA-binding domain containing protein; possible homolog of yeast Ada2 protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF04433 ) SWIRM domain
  • ( PF07649 ) C1-like domain
  • ( PF00569 ) Zinc finger, ZZ type
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF04642 ) Protein of unknown function, DUF601
  • ( TIGR01557 ) myb-like DNA-binding domain, SHAQKYF class

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00790730

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01741 ) Micronucleus: PAR1 gene partially replaced by neo4-KanR2 cassette. Macronucleus: ADA2 gene partially replaced by neo4-KanR2 cassette.

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05602.19.997093137033517e-262myb-like DNA-binding domain-co
ntaining protein (523 aa)
OxytrichaContig22251.0.g515.000518477595783e-71Myb-like DNA-binding domain
SGDYDR448W7.002037867398653e-67ADA2 Transcription coactivator
, component of the ADA and SAG
A transcriptional adaptor/HAT
(histone acetyltransferase) co
mplexes
DictyBaseDDB_G02800791.9999167998962255e-60ada2 on chromosome: 3 position
2899122 to 2902089
Stentor CoeruleusSteCoe_238661.9287498479639178e-22
WormBaseWBGene000179670.000000030002053728821195locus:ada-2 status:Partially
_confirmed UniProt:Q19953
protein_id:CCD66269.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10
  2. Ref:SUPR000283

Sequences

>TTHERM_00790730(coding)
ATGTGCAGCATTAATGCTTTAAAAAAGAGCAACAGGGGAGGCAAGAAATCACCTCAAAAA
AAATCGGATGACAAGAAGGACATCTTGCAGACAACCATTTTCAACAATTTATACTATCCT
TCAAACAGAGTCCACTGTGATGCATGTGAAAAAGATATTAGCAAGCAAGTTAAAATATAT
TGTCCTGGCTCCTAATCAGATATTTGCATGAACTGCTTTGCAGATGGAGTAGAATTCAAT
AGTCACAAAATTGATGAAGATTATCATGTTATCAACAAATTAAATTATCCTCTTTTAGCT
GATGATTGGACTTGCGAAGAAGAGTTGCTTTTATTCGAAGGTCTAGAGAGATTTGGTTTC
GGTAACTGGTAGGACATAGCAGATCACATTGGTACTGACAAAACAAAGGAAGATGTTGAA
AAGCACTACGAAGAATGTCATTTAGATGCTTCTACTAAAGGATTTTACCCTTAAGAGAAA
GCTTAGTTTTTAACTAGAAGAGATGAAAAAACCTTAGAACTTCACATCACTAAGAGTGGA
AAGAACTCAAATTAAATGCAAGAAGAAAAAGCTGGTAGAAAGAAATCAGCTAGATCACTC
GAAAAGAATGCACAACCTCCTGGTATTTAATAATCTTCTATTTCTACCTCAAATGCTCGT
GCATTAACAACACCTAATTAAGGAAATTTGCAAACCAATTAATAAAATACTACTAATCAT
GCACAAAATGGTAATGCTTAAGATATTGTCGGCTACATGCCCTTGAGAGGTGATTTTGAT
ATCGAGTACGACAATGATGCAGAACTTCTACTTGCTGAAATGGAGTTTAACGATGACGAC
AAAGACACAGAGCTTAAAATGAAATACAAACTTTTAGAAATCTATAATGCCAGACTAGAT
GAAAGAATCAAGCGTAAAAAATTCGTCATAGAAAGAGGACTCCTCGACCTAAAGAAATAA
AACAATTTAGATAAGGAAAGGACTAAAGAAGAAAAGGAAATATATAATATGATGAAGGTA
TTCAGTAGATTTAGTAAACCTGAAGAACACGAAAGATTAGTTTAAGGAATTATAAAGGAA
AAGCAAATTCGTTAACGTATAGAAGAGCTTAAAACTTACCGTAAATTAGGGTTGAAAACA
TTTGAAGATGTAGAGAATTACTTAAATTAAAAGAGAAAAAATGATGAAAATTTCAATAAA
AGATAAAAAAATAACGAAAAAATGTTATAAGAAAAGTCATCTGTTGCTTCTTCTCAAGGC
AATAGATAAACATCACGTAGAACTCGTTCTTTGAACATGTTTGTAGAAAATAAGGATCAT
GTTACAGACAAAAAGAAACAGCTTCCTCCAAATGTTACCGAACAAGAAATAGAGTTGTGT
GATAAGCTCAATATATCTCCATATGAGTATTTGGTTATGAAAGAAGTTCTTGTTAGATAA
GCTATTTAGGAAGGATTTATAAAAATTGAATATGCATAACACAAACTTAAATTAGATAAA
GATCGTGTAACTGGCATATTCGACTTTTTAGTTGCACATAAATATATTTTAGAAAAGAAG
TGA


>TTHERM_00790730(protein)
MCSINALKKSNRGGKKSPQKKSDDKKDILQTTIFNNLYYPSNRVHCDACEKDISKQVKIY
CPGSQSDICMNCFADGVEFNSHKIDEDYHVINKLNYPLLADDWTCEEELLLFEGLERFGF
GNWQDIADHIGTDKTKEDVEKHYEECHLDASTKGFYPQEKAQFLTRRDEKTLELHITKSG
KNSNQMQEEKAGRKKSARSLEKNAQPPGIQQSSISTSNARALTTPNQGNLQTNQQNTTNH
AQNGNAQDIVGYMPLRGDFDIEYDNDAELLLAEMEFNDDDKDTELKMKYKLLEIYNARLD
ERIKRKKFVIERGLLDLKKQNNLDKERTKEEKEIYNMMKVFSRFSKPEEHERLVQGIIKE
KQIRQRIEELKTYRKLGLKTFEDVENYLNQKRKNDENFNKRQKNNEKMLQEKSSVASSQG
NRQTSRRTRSLNMFVENKDHVTDKKKQLPPNVTEQEIELCDKLNISPYEYLVMKEVLVRQ
AIQEGFIKIEYAQHKLKLDKDRVTGIFDFLVAHKYILEKK


>TTHERM_00790730(gene)
ATGTGCAGCATTAATGCTTTGTTTTTTTTAAATTATCTAGGAAGTTTGACATCAAAGACG
ATAAGTAACTAGCTTTTTCACATTATGGAATTGATTATCATAATCGCGATTTAAAACAAT
AATTCTTGCAATTATCAGCAAAAATTCAATTCAAAAATGACAGCATTGAAGCATCAAAAT
GTTTTAACAATTTTTGATAATAAAAAATAGAAAAAAGAGCAACAGGGGAGGCAAGAAATC
ACCTCAAAAAAAATCGGATGACAAGAAGGACATCTTGCAGACAACCATTTTCAACGTATA
AAAACCAAATATTTATTTGACTTTATTATTTCTTTACGAAATTGAATCAATTAAAAGGAC
AATCAATCAATGCTCGCTTAATAAAAACTTTGCTTGTTTTCCTCCTTATTAATTTTATTA
ATCTTGTTTGATAAAAATCAATTCAGATACAAAGAATATCACTGCTAATTAATTTAAAAA
TAAAACAATAAGCAAACAAGCTAACTAAATAGCAAGAAAACTAATTAACCAATTCATTTA
GAAATAAATTGATTGTCTGTATGTCTGTCTTGTACTTCAAACACCAAAATATTAATCTCA
AATTAAGCACCAAAATAAATAACACATTTTTATGATTTAAATAGAATTTATACTATCCTT
CAAACAGAGTCCACTGTGATGCATGTGAAAAAGATATTAGCAAGCAAGTTAAAATATATT
GTCCTGGCTCCTAATCAGATATTTGCATGAACTGCTTTGCAGATGGAGTAGAATTCAATA
GTCACAAAATTGATGAAGATTATCATGTTATCAACAAATTAAATTATCCTCTTTTAGCTG
ATGATTGGACTTGCGAAGAAGAGTTGCTTTTATTCGAAGGTCTAGAGAGATTTGGTTTCG
GTAACTGGTAGGACATAGCAGATCACATTGGTACTGACAAAACAAAGGAAGATGTTGAAA
AGCACTACGAAGAATGTCATTTAGATGCTTCTACTAAAGGATTTTACCCTGTAAATTAAT
ATATTCATTTATTTTCACTTAGCAAGTATCTCATAATCAATTCAAAAAAACAAACAAATA
AATAAATCAGATTTTGCATCAAAATTTCATTTAAATAAAAGAAAAGTGAAATAATTAATT
AGCTATTTCTAAATGATCAATTAGAAGTTTCAAAGCTTTCAACAATTAGCTGATAAATTT
TATATTTCTTAATTCTATCAGTAATAATCAAACAAAATTAATGTTTTAAATTTAGCTAGG
TCTCAGATAAACGAATAAATGAATTTAAATAAAGAAAGATAGTTATTAAATCACATTTAT
CTCAAAATTGTTTAAAAAAATCGAATAAAGATTTAGAAATAATTTATTTGTTTATCAGCA
AATTATCGAATTTGAAGAATGTTGTTTGAACCAAACAAAAAAACAACAATAATAAAAATA
AACAAAAAAAGAAGCTAACTTAATTTAAATCTACTTTCTAAAAAATAGTAAGAGAAAGCT
TAGTTTTTAACTAGAAGAGATGAAAAAACCTTAGAACTTCACATCACTAAGAGTGGAAAG
AACTCAAATTAAATGCAAGAAGAAAAAGCTGGTAGAAAGAAATCAGCTAGATCACTCGAA
AAGAATGCACAACCTCCTGGTATTTAATAATCTTCTATTTCTACCTCAAATGCTCGTGCA
TTAACAACACCTAATTAAGGAAATTTGCAAACCAATTAATAAAATACTACTAATCATGCA
CAAAATGGTAATGCTTAAGATATTGTCGGCTACATGCCCTTGAGAGGTGATTTTGATATC
GAGTACGACAATGATGCAGAACTTCTACTTGCTGAAATGGAGTTTAACGATGACGACAAA
GACACAGAGCTTAAAATGAAATACAAACTTTTAGAAATCTATAATGCCAGACTAGATGAA
AGAATCAAGCGTAAAAAATTCGTCATAGAAAGAGGACTCCTCGACCTAAAGTATGCTTTC
ATTTTTTTCAAATTTTAATTGCTTTATTAAAGTAATTAAACAAATTTTAAATTCTAAATA
GGAAATAAAACAATTTAGATAAGGAAAGGACTAAAGAAGAAAAGGAAATATATAATATGA
TGAAGGTATTCAGTAGATTTAGTAAACCTGAAGAACACGAAAGATTAGTTTAAGGAATTA
TAAAGGAAAAGCAAATTCGTTAACGTATAGAAGAGCTTAAAACTTACCGTAAATTAGGGT
TGAAAACATTTGAAGATGTAGAGAATTACTTAAATTAAAAGAGAAAAAATGATGAAAATT
TCAATAAAAGATAAAAAAATAACGAAAAAATGTTATAAGAAAAGTCATCTGTTGCTTCTT
CTCAAGGCAATAGATAAACATCACGTAGAACTCGTTCTTTGAACATGTTTGTAGAAGTAA
TTAAATCTATTTTATTTACATTGTAAACAAAGAATTATTTTTTTTAGAATAAGGATCATG
TTACAGACAAAAAGAAACAGCTTCCTCCAAATGTTACCGAACAAGTACTAAACAAGTTTT
AATATAAAAATATTATAAATAAATTTAATTATTTAAATTAAAAATCAATTTAGGAAATAG
AGTTGTGTGATAAGCTCAATATATCTCCATATGAGTATTTGGTTATGAAAGAAGTTCTTG
TTAGATAAGCTATTTAGGAAGGATTTATAAAAATTGAATATGCATAACACAAACTTAAAT
TAGGTAAACATTTTAATTTAAATATCTTTTATTTAAACTTTAAATAAAATTTAGATAAAG
ATCGTGTAACTGGCATATTCGACTTTTTAGTTGCACATAAATATATTTTAGAAAAGAAGT
GA