Identifiers and Description

Gene Model Identifier

TTHERM_00190950

Standard Name

ACT1 (ACTin)

Aliases

PreTt08746 | 15.m00457 | actin | 3697.m00168

Description

Actin; structural protein; monomeric subunits of the actin protein (G-actin) polymerize to form structural filiaments (F-actin); localized to the cleavage forrow during cytokinesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00190950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_322510
WormBaseWBGene000000669.997093137033517e-262locus:act-4 Actin-4 status
:Confirmed UniProt:P10986
protein_id:CCD83476.1
Tetrahymena borealisEI9_06202.19.997093137033517e-262actin, macronuclear (377 aa)
DictyBaseDDB_G02750239.997093137033517e-262act22 on chromosome: 2 positio
n 5343575 to 5344705
OxytrichaContig4562.0.g749.997093137033517e-262Actin
SGDYFL039C9.997093137033517e-262ACT1 Actin, structural protein
involved in cell polarization
, endocytosis, and other cytos
keletal functions

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16524910: Williams NE, Tsao CC, Bowen J, Hehman GL, Williams RJ, Frankel J (2006) The actin gene ACT1 is required for phagocytosis, motility, and cell separation of Tetrahymena thermophila. Eukaryotic cell 5(3):555-67
  2. Ref:16593729: Cupples CG, Pearlman RE (1986) Isolation and characterization of the actin gene from Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 83(14):5160-4

Sequences

>TTHERM_00190950(coding)
ATGGCTGAAAGTGAATCCCCCGCTATTGTTATTGATAACGGTTCCGGTATGTGCAAGGCT
GGTATTGCTGGTGACGATGCTCCCAGAGCCGCCTTCCCCTCCATTGTCGGTAGACCCAAA
ATGCCTGGTATCATGGTCGGTATGGATCAAAAGGAATGCTACGTTGGTGAAGAAGCCCAA
GCCAAGAGAGGTGTTTTGAATTTGAAATATCCCATTGAACACGGTATTGTCACCGATTAC
GATGATATGGAAAAGATCTGGCATCACTGCTTCTACAATGAACTCAGAGTTACCCCTGAA
GAACACCCCTGCTTACTTACTGAAGCTCCCCAAAACCCCAAGTTGAACAGAGAAAAGATG
ACCAAGACCATGTTCGAAACTTTCAACGTTCCCTCCTTCTACGTTGCCATCCAAGCCGTT
CTTTCCCTCTACGCTTCCGGTAGAACCACTGGTATCGTCGTTGACTCTGGTGATGGTGTT
ACCCACACTGTTCCCATCTATGAAGGTTACGCTCTTCCTCACGCCATCTTGAGAATCGAT
TTGGCTGGTAGAGACTTAACTGAATACTGCATGAAGCTCCTCTACGAAATTGGTTTGAAC
TTCTCTTCCACTGCCGAAAGAGAAATCATCAGAGATATCAAGGAAAAGCTCTGCTACGTC
GCTATCGACTACGAAGCTGAATTAAAGGCTTACAAGGAATCCTCCTAAAACGATAAATCT
TACGAATTACCCGATGGTAACACCATTACCGTCCAAGACTAGAGATTCAGATGCCCTGAA
CTCCTCTTCAAGCCTGCCTTCATCGGTAAGGAATTCCCTGGTATCCACGAACTTACCTTC
AACTCTATCATGAAGTGTGATGTCGATGTCAGAAAGGATCTTTACAACAACATCGTCCTC
TCTGGTGGTACCACTATGTTCCCTGGTATTGCTGAAAGACTTTCTAAGGAAGTTAGCGCT
CTTGCTCCTTCTTCCATGAAGATTAAGGTTGTTGCTCCTCCTGAGAGAAGATACTCTGTC
TGGATTGGTGGTTCCATTCTTTCCTCTCTTTCTACCTTCCAAACTATGTGGATTACTAAG
GCTGAATATGATGAATCTGGTCCTTCCATCGTCCACAGAAAGTGCTTCTGA


>TTHERM_00190950(protein)
MAESESPAIVIDNGSGMCKAGIAGDDAPRAAFPSIVGRPKMPGIMVGMDQKECYVGEEAQ
AKRGVLNLKYPIEHGIVTDYDDMEKIWHHCFYNELRVTPEEHPCLLTEAPQNPKLNREKM
TKTMFETFNVPSFYVAIQAVLSLYASGRTTGIVVDSGDGVTHTVPIYEGYALPHAILRID
LAGRDLTEYCMKLLYEIGLNFSSTAEREIIRDIKEKLCYVAIDYEAELKAYKESSQNDKS
YELPDGNTITVQDQRFRCPELLFKPAFIGKEFPGIHELTFNSIMKCDVDVRKDLYNNIVL
SGGTTMFPGIAERLSKEVSALAPSSMKIKVVAPPERRYSVWIGGSILSSLSTFQTMWITK
AEYDESGPSIVHRKCF


>TTHERM_00190950(gene)
ATGGCTGAAAGTGAATCCCCCGCTATTGTTATTGATAACGGTTCCGGTATGTGCAAGGCT
GGTATTGCTGGTGACGATGCTCCCAGAGCCGCCTTCCCCTCCATTGTCGGTAGACCCAAA
ATGCCTGGTATCATGGTCGGTATGGATCAAAAGGAATGCTACGTTGGTGAAGAAGCCCAA
GCCAAGAGAGGTGTTTTGAATTTGAAATATCCCATTGAACACGGTATTGTCACCGATTAC
GATGATATGGAAAAGATCTGGCATCACTGCTTCTACAATGAACTCAGAGTTACCCCTGAA
GAACACCCCTGCTTACTTACTGAAGCTCCCCAAAACCCCAAGTTGAACAGAGAAAAGATG
ACCAAGACCATGTTCGAAACTTTCAACGTTCCCTCCTTCTACGTTGCCATCCAAGCCGTT
CTTTCCCTCTACGCTTCCGGTAGAACCACTGGTATCGTCGTTGACTCTGGTGATGGTGTT
ACCCACACTGTTCCCATCTATGAAGGTTACGCTCTTCCTCACGCCATCTTGAGAATCGAT
TTGGCTGGTAGAGACTTAACTGAATACTGCATGAAGCTCCTCTACGAAATTGGTTTGAAC
TTCTCTTCCACTGCCGAAAGAGAAATCATCAGAGATATCAAGGAAAAGCTCTGCTACGTC
GCTATCGACTACGAAGCTGAATTAAAGGCTTACAAGGAATCCTCCTAAAACGATAAATCT
TACGAATTACCCGATGGTAACACCATTACCGTCCAAGACTAGAGATTCAGATGCCCTGAA
CTCCTCTTCAAGCCTGCCTTCATCGGTAAGGAATTCCCTGGTATCCACGAACTTACCTTC
AACTCTATCATGAAGTGTGATGTCGATGTCAGAAAGGATCTTTACAACAACATCGTCCTC
TCTGGTGGTACCACTATGTTCCCTGGTATTGCTGAAAGACTTTCTAAGGAAGTTAGCGCT
CTTGCTCCTTCTTCCATGAAGATTAAGGTTGTTGCTCCTCCTGAGAGAAGATACTCTGTC
TGGATTGGTGGTTCCATTCTTTCCTCTCTTTCTACCTTCCAAACTATGTGGATTACTAAG
GCTGAATATGATGAATCTGGTCCTTCCATCGTCCACAGAAAGTGCTTCTGA