Identifiers and Description

Gene Model Identifier

TTHERM_00037470

Standard Name

ACO1 (ACOnitase)

Aliases

PreTt14482 | 2.m02109 | 3825.m02851

Description

aconitate hydratase 1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00037470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_235730
WormBaseWBGene000000409.997093137033517e-262locus:aco-1 Probable cytopla
smic aconitate hydratase sta
tus:Confirmed UniProt:Q23500
protein_id:CAA91491.1
Tetrahymena borealisEI9_01001.19.997093137033517e-262aconitate hydratase 1 family p
rotein (906 aa)
DictyBaseDDB_G02791599.997093137033517e-262aco1 on chromosome: 3 position
1708174 to 1711261
OxytrichaContig1319.1.g1079.997093137033517e-262Aconitase family (aconitate hy
dratase)
SGDYLR304C2.0002571866765887e-62ACO1 Aconitase, required for t
he tricarboxylic acid (TCA) cy
cle and also independently req
uired for mitochondrial genome
maintenance; phosphorylated;
component of the mitochondrial
nucleoid; mutation leads to g
lutamate auxotrophy

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037470(coding)
ATGTACAGAAAGATCACCTGCAACTTCTCTGCCCTCAACAACCCCTTCTAAAAGAATTTT
AAGTAATTGAAGGTTGAAGGAAAGAACTATAACTTCTACAGTCTCCCCGACCTCCATGAC
GCTAGATTAGAAAAGTTACCCTACTCAGTTAGAATTTTATTAGAATCTGCTGTTAGAAAC
TGCGATGAATTCAACGTTAAAAAGGCTGATGTTGAAAAGATCTTAGCTTGGGAAAAGAAC
TCAACTCAACAAATTGAAATCCCCTTCAAGCCCGCTAGAGTTATCTTATAAGATTTCACT
GGTGTCCCAGCTGTTGTTGATTTCGCTGCTATGAGAGACGCTATGGTCCGTTTGGGTGGA
GATCCCAACAAGATCAACCCCTTGTGCCCTGTTGATTTGGTTATCGATCACTCTGTCCAA
GCTGATGTTGCTAGAGACTTGAAGGCCTTTGAGAAGAACGAAGAAATCGAATTCAACAGA
AACTACGAAAGATTCGAATTCTTAAAGTGGGGTTAAAAAGCTCTTAACAACTTCACCATT
GTTCCTCCTGGTTCTGGTATTGTCCATCAAGTTAACTTAGAATACTTAGCCAGAGTCGTT
TTCAACAACGAAAATGGTGTCCTCTATCCTGATTCCGTCGTCGGTACTGATTCCCACACC
ACTATGATTAACGGTTTGGGTGTCCTCGGTTGGGGTGTTGGTGGTATTGAAGCTGAAGCT
GTTATGCTCGGTCAATGTATTTCCATGGTCTTACCTGAAGTCGTTGGTTTCAAGCTTTAT
GGTAAATTGAAGGAACACGTCACTGCTACCGATTTGGTTTTGACTTGCACTCAAATGCTC
AGAAAGAGAGGTGTCGTCGGTAAATTCGTCGAATTCTTCGGTCCTGGTTGTGAAAATCTC
TCTCTTGCTGATAGAGCTACAATTGCTAACATGGCTCCTGAATACGGTGCCACCATGGGT
TACTTCCCTATTGATGCCTAATCTGTTGACTACTTGAAGCTCACCGGCAGAGACTCTCAC
AAGGTTAAGGTTATCGAAAGCTATCTTAGAGAATAAGGTCTCTTCAGAACCAGCAGCTCT
AAGGACCCCGTTTATACTGGTGCTGTTCTTGAATTAGATCTTGCCTCAGTCCAACCCTGT
ATTTCTGGCCCCAAGAGACCCCACGACAGAGTTCCCCTCAACGAAATGAAATCAGAATGG
AATTAAATCCTTACTGCTAAGACTGGCTTCAAGGGATTCGGTTTAACTGAATAATAATCA
AAAAAGACCCACACTTTCAACTATAAGGGTACTGACTACACTCTTTCTAACGGTTCCGTT
GTTGTTGCTGCTATTACTTCCTGCACTAACACTTCCAACCCTGACTCCATGGTTGCTGCT
GGTCTCCTTGCCAAGGCTGCCGTTGAAAAGGGTTTGAATGTCAAGCCTTACATCAAAACC
ACTTTATCTCCTGGTTCTGGTGTCGTTACTAAGTACTTCGTTGAATCTGGTGTTCAATCT
TACTTAGAATAATTAGGTTTCACCACTGCTGGTTATGGTTGCATGACCTGTATTGGTAAC
ACTGGTGAATTAGAACCCGAAGTTGACCAAGCTATCAGATAAGGTGATGTTGTTGCTGCT
GCTGTTTTATCTGGTAACAGAAACTTCGAAGGTCGTATCCACCCCTTAACCAGAGCTAAC
TACTTGGCTTCTCCTGCTTTGGTTGTTGCTTATGCTTTAGCTGGAACTGTTAACATTGAT
TTCGAAACTGAACCTATTGGAACTGATAAGCACGGTAAGGCTGTCTTCTTGAAGGATATC
TGGCCCTCTAGAACCTTCACTCAAGACACCGTCCACAAGTCTCTTAGACCTGAAATGTTC
AGCGAAGTTTACAAGAGAATTTCTCAAGGTACCGCCAGATGGAATGCTTTGAAGGCTTCT
GACAAGAAGGTTTATGACTGGAAGGCTGAATCCACTTATATCCACAATCCTCCCTTCTTC
TAGACCACTGAACTCGTTCCCAAGCCCGTCTAGAGCATCAAGAGTGCCTACTGTTTATTG
AACTTAGGTGATTCTATTACTACCGATCACATCTCCCCTGCTGGTAACATCGCTAAGAAC
TCTCCTGCTGCCAGATACCTTAACGAACGTGGTATCTAATCTAAGGACTTCAACACTTAT
GGTGCTAGAAGAGGTAACGATGAAATCATGGCTAGAGGTACTTTTGCTAACGTCAGATTA
ATCAACAAGATGATGGATAAGGTTGGTCCTGAAACTGTTCACATCCCCTCAGGATAAAAG
CTTGCTGTCTTCGATGCTGCTGAAAAGTATCAAAAGGAAGGTCACTAACTTATTGTCCTT
GCTGGTCAAGAATACGGTTCTGGTTCTTCTAGAGATTGGGCTGCCAAGGGTCCCTACTTA
CAAGGTATCAAGGCTGTTATTGCTCAAAGCTATGAAAGAATTCACAGATCTAACTTAGTT
GGTATGGGTATCTTACCTTGCGAATTCTTAAATGGATAAAACGCTGACAGCTTAGGTTTG
AATGGTCATGAAACTTTCAACATTGACTTAAAGGGTGGAAACTTAAAGGTTAACGAAGTC
TTGACTGTTACTACTAGCACTGGTAAATCCTTCCAAGTTAAGACCAGATTAGATACTGAT
GTCGAAATTGCTTACTTCTAAAACGGTGGTATCCTCCAATACGTCCTTAGAAAGCTTGTC
AAGGGTGAAGCTCAATGA


>TTHERM_00037470(protein)
MYRKITCNFSALNNPFQKNFKQLKVEGKNYNFYSLPDLHDARLEKLPYSVRILLESAVRN
CDEFNVKKADVEKILAWEKNSTQQIEIPFKPARVILQDFTGVPAVVDFAAMRDAMVRLGG
DPNKINPLCPVDLVIDHSVQADVARDLKAFEKNEEIEFNRNYERFEFLKWGQKALNNFTI
VPPGSGIVHQVNLEYLARVVFNNENGVLYPDSVVGTDSHTTMINGLGVLGWGVGGIEAEA
VMLGQCISMVLPEVVGFKLYGKLKEHVTATDLVLTCTQMLRKRGVVGKFVEFFGPGCENL
SLADRATIANMAPEYGATMGYFPIDAQSVDYLKLTGRDSHKVKVIESYLREQGLFRTSSS
KDPVYTGAVLELDLASVQPCISGPKRPHDRVPLNEMKSEWNQILTAKTGFKGFGLTEQQS
KKTHTFNYKGTDYTLSNGSVVVAAITSCTNTSNPDSMVAAGLLAKAAVEKGLNVKPYIKT
TLSPGSGVVTKYFVESGVQSYLEQLGFTTAGYGCMTCIGNTGELEPEVDQAIRQGDVVAA
AVLSGNRNFEGRIHPLTRANYLASPALVVAYALAGTVNIDFETEPIGTDKHGKAVFLKDI
WPSRTFTQDTVHKSLRPEMFSEVYKRISQGTARWNALKASDKKVYDWKAESTYIHNPPFF
QTTELVPKPVQSIKSAYCLLNLGDSITTDHISPAGNIAKNSPAARYLNERGIQSKDFNTY
GARRGNDEIMARGTFANVRLINKMMDKVGPETVHIPSGQKLAVFDAAEKYQKEGHQLIVL
AGQEYGSGSSRDWAAKGPYLQGIKAVIAQSYERIHRSNLVGMGILPCEFLNGQNADSLGL
NGHETFNIDLKGGNLKVNEVLTVTTSTGKSFQVKTRLDTDVEIAYFQNGGILQYVLRKLV
KGEAQ


>TTHERM_00037470(gene)
ATGTACAGAAAGATCACCTGCAACTTCTCTGCCCTCAACAACCCCTTCTAAAAGAATTTT
AAGTAATTGAAGGTTGAAGGAAAGAACTATAACTTCTACAGTCTCCCCGACCTCCATGAC
GCTAGATTAGGTAACAACAATAAGAAGCTTGCCTTGTTTGTCTATATTTTTCTCTCACTC
TTACTCTGCTTTAATCCTCCTCCTACTTTCAATTTTTAAATAAGACCAAAATGCGTACAA
AAAATACTTTTTGCTCCTATGCTTTAAAATAATTAGAGAAAATGAATACAGAAAAGCATT
AGCTCCACATAAGCATCTCGAAAATAATGGTTTATTGAAAATTGGTAGAATGCTTCTTGA
GAATATTGAATTTTTCTAATTATATTCTCTACTTAAAGTTTCTACTTAAATGGATTTAGC
TTAAAACAGTAGAAAGAAGGGAAAAAAAGAGAGAGAAGAAAACAATCTTTAAAACAAGCT
ATTTTAGTCAAAGCATTTTTAAAATATTTTTTATTATAAATTATAAAATAGAAAAGTTAC
CCTACTCAGTTAGAATTTTATTAGAATCTGCTGTTAGAAACTGCGATGAATTCAACGTTA
AAAAGGCTGATGTTGAAAAGATCTTAGCTTGGGAAAAGAACTCAACTCAACAAATTGAAA
TCCCCTTCAAGCCCGCTAGAGTTATCTTATAAGATTTCACTGGTGTCCCAGCTGTTGTTG
ATTTCGCTGCTATGAGAGACGCTATGGTCCGTTTGGGTGGAGATCCCAACAAGATCAACC
CCTTGTGCCCTGTTGATTTGGTTATCGATCACTCTGTCCAAGCTGATGTTGCTAGAGACT
TGAAGGCCTTTGAGAAGAACGAAGAAATCGAATTCAACAGAAACTACGAAAGATTCGAAT
TCTTAAAGTGGGGTTAAAAAGCTCTTAACAACTTCACCATTGTTCCTCCTGGTTCTGGTA
ATAAACAACAAAATCAATAACATTTTATTTATTTATTTCTAGCTATTTGAAAGCTAGTTT
TTTTTAAAACCTAAAAGATTAATACATAATAAGCTGATTATTTATACAAAAGAATATGAA
AGATATTTTCGGAATAAGTAAAAAGAAAAAGATACATGAATTTAGTTAGAATTTATTAAA
TGATAAGCAATTGCAAATATTTTTTTCAAAGTTCAAATAAAACATATTATTTAGAAGGGA
GATGGAATCAGTTTTCGAATCTTATTTTTTATGAAAATTGATATTTTATTAATTTATAAA
GATTTTATCAAAGAATTTTTTTCAAGATTTAAATAAAAATTATATTTTTGATAGAAAAAA
AAATAGATAAATAAAAAACGATATTTTATTTACACTGATCTAATTAATTTATTTATAATA
AATCATATCACATCACAACCAGCTTTTTATAATAATTAAATACGCTCTCAACTGATTTCA
TTCCCTAATCTAATAAAATTCCAATATCTTATTAATTTATTTTATTCAATCATTGAAACA
CTATTTTAAAACATCCCTTTATTTCATAGACAGCCCACACAAAAAACAAAATAGCAAATA
AATAAACAATATCTATTTAATTATTTTCAAATAATCCCTCTATCAATTTTACATGATAGA
GTTAAGACTCTTTGAAATTTTTTTCTTAATTATGCAATGATGCTTATCAAAATCATAACA
ACTGAAGATAAATATTTGACTTTTTGATTGCTTAAAATAAATATTTGAATTTTTTAGTAG
CTTATTTTATTTAAAAAAATACTTTTAAAATCCAATTCAATTGATTTAATTATTATAATT
TATAAATTATAGGTATTGTCCATCAAGTTAACTTAGAATACTTAGCCAGAGTCGTTTTCA
ACAACGAAAATGGTGTCCTCTATCCTGATTCCGTCGTCGGTACTGATTCCCACACCACTA
TGATTAACGGTTTGGGTGTCCTCGGTTGGGGTGTTGGTGGTATTGAAGCTGAAGCTGTTA
TGCTCGGTCAATGTATTTCCATGGTCTTACCTGAAGTCGTTGGTTTCAAGCTTTATGGTA
AATTGAAGGAACACGTCACTGCTACCGATTTGGTTTTGACTTGCACTCAAATGCTCAGAA
AGAGAGGTGTCGTCGGTAAATTCGTCGAATTCTTCGGTCCTGGTTGTGAAAATCTCTCTC
TTGCTGATAGAGCTACAATTGCTAACATGGCTCCTGAATACGGTGCCACCATGGGTTACT
TCCCTATTGATGCCTAATCTGTTGACTACTTGAAGCTCACCGGCAGAGACTCTCACAAGG
TTAAGGTTATCGAAAGCTATCTTAGAGAATAAGGTCTCTTCAGAACCAGCAGCTCTAAGG
ACCCCGTTTATACTGGTGCTGTTCTTGAATTAGATCTTGCCTCAGTCCAACCCTGTATTT
CTGGCCCCAAGAGACCCCACGACAGAGTTCCCCTCAACGAAATGAAATCAGAATGGAATT
AAATCCTTACTGCTAAGACTGGCTTCAAGGGATTCGGTTTAACTGAATAATAATCAAAAA
AGACCCACACTTTCAACTATAAGGGTACTGACTACACTCTTTCTAACGGTTCCGTTGTTG
TTGCTGCTATTACTTCCTGCACTAACACTTCCAACCCTGACTCCATGGTTGCTGCTGGTC
TCCTTGCCAAGGCTGCCGTTGAAAAGGGTTTGAATGTCAAGCCTTACATCAAAACCACTT
TATCTCCTGGTTCTGGTGTCGTTACTAAGTACTTCGTTGAATCTGGTGTTCAATCTTACT
TAGAATAATTAGGTTTCACCACTGCTGGTTATGGTTGCATGACCTGTATTGGTAACACTG
GTGAATTAGAACCCGAAGTTGACCAAGCTATCAGATAAGGTGATGTTGTTGCTGCTGCTG
TTTTATCTGGTAACAGAAACTTCGAAGGTCGTATCCACCCCTTAACCAGAGCTAACTACT
TGGCTTCTCCTGCTTTGGTTGTTGCTTATGCTTTAGCTGGAACTGTTAACATTGATTTCG
AAACTGAACCTATTGGAACTGATAAGCACGGTAAGGCTGTCTTCTTGAAGGATATCTGGC
CCTCTAGAACCTTCACTCAAGACACCGTCCACAAGTCTCTTAGACCTGAAATGTTCAGCG
AAGTTTACAAGAGAATTTCTCAAGGTACCGCCAGATGGAATGCTTTGAAGGCTTCTGACA
AGAAGGTTTATGACTGGAAGGCTGAATCCACTTATATCCACAATCCTCCCTTCTTCTAGA
CCACTGAACTCGTTCCCAAGCCCGTCTAGAGCATCAAGAGTGCCTACTGTTTATTGAACT
TAGGTGATTCTATTACTACCGATCACATCTCCCCTGCTGGTAACATCGCTAAGAACTCTC
CTGCTGCCAGATACCTTAACGAACGTGGTATCTAATCTAAGGACTTCAACACTTATGGTG
CTAGAAGAGGTAACGATGAAATCATGGCTAGAGGTACTTTTGCTAACGTCAGATTAATCA
ACAAGATGATGGATAAGGTTGGTCCTGAAACTGTTCACATCCCCTCAGGATAAAAGCTTG
CTGTCTTCGATGCTGCTGAAAAGTATCAAAAGGAAGGTCACTAACTTATTGTCCTTGCTG
GTCAAGAATACGGTTCTGGTTCTTCTAGAGATTGGGCTGCCAAGTAATAAAATTTTATTT
ATTTTTTTTATTAATCAAGTAATTTTAATATTTTAGGGGTCCCTACTTACAAGGTATCAA
GGCTGTTATTGCTCAAAGCTATGAAAGAATTCACAGATCTAACTTAGTTGGTATGGGTAT
CTTACCTTGCGAATTCTTAAATGGATAAAACGCTGACAGCTTAGGTTTGAATGGTCATGA
AACTTTCAACATTGACTTAAAGGGTGGAAACTTAAAGGTTAACGAAGTCTTGACTGTTAC
TACTAGCACTGGTAAATCCTTCCAAGTTAAGACCAGATTAGATACTGATGTCGAAATTGC
TTACTTCTAAAACGGTGGTATCCTCCAATACGTCCTTAGAAAGCTTGTCAAGGGTGAAGC
TCAATGA