Identifiers and Description

Gene Model Identifier

TTHERM_00137850

Standard Name

ABC2 (ABC transporter protein 2)

Aliases

PreTt24411 | 10.m00460 | 3698.m00178

Description

ABC transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF07650 ) KH domain
  • ( TIGR01978 ) FeS assembly ATPase SufC
  • ( TIGR00955 ) pigment precursor permease
  • ( TIGR01194 ) cyclic peptide transporter
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( PF03002 ) Somatostatin/Cortistatin family
  • ( TIGR00958 ) antigen peptide transporter 2
  • ( TIGR01842 ) type I secretion system ATPase
  • ( TIGR01846 ) type I secretion system ATPase
  • ( TIGR03375 ) type I secretion system ATPase
  • ( TIGR01288 ) nodulation ABC transporter NodI
  • ( TIGR01193 ) ABC-type bacteriocin transporter
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF00664 ) ABC transporter transmembrane region
  • ( TIGR01192 ) glucan exporter ATP-binding protein
  • ( TIGR00739 ) preprotein translocase, YajC subunit
  • ( TIGR02673 ) cell division ATP-binding protein FtsE
  • ( TIGR02769 ) nickel import ATP-binding protein NikE
  • ( TIGR02770 ) nickel import ATP-binding protein NikD
  • ( PF05115 ) Cytochrome B6-F complex subunit VI
  • ( TIGR02323 ) phosphonate C-P lyase system protein
  • ( TIGR02857 ) thiol reductant ABC exporter, CydD
  • ( TIGR02868 ) thiol reductant ABC exporter, CydC
  • ( TIGR01166 ) cobalt ABC transporter, ATP-binding protein
  • ( TIGR01189 ) heme ABC exporter, ATP-binding protein
  • ( TIGR00968 ) sulfate ABC transporter, ATP-binding protein
  • ( TIGR00954 ) Peroxysomal long chain fatty acyl
  • ( TIGR01277 ) thiamine ABC transporter, ATP-binding protein
  • ( TIGR02204 ) ABC transporter, permease/ATP-binding protein
  • ( TIGR02982 ) ABC exporter ATP-binding subunit, DevA
  • ( PF01741 ) Large-conductance mechanosensitive channel, MscL
  • ( TIGR00957 ) multi drug resistance-associated protein (MRP)
  • ( TIGR00972 ) phosphate ABC transporter, ATP-binding protein
  • ( TIGR01187 ) polyamine ABC transporter, ATP-binding protein
  • ( TIGR02142 ) molybdate ABC transporter, ATP-binding protein
  • ( TIGR03410 ) urea ABC transporter, ATP-binding protein
  • ( TIGR03411 ) urea ABC transporter, ATP-binding protein
  • ( TIGR02203 ) lipid A export permease/ATP-binding protein
  • ( TIGR02315 ) phosphonate ABC transporter, ATP-binding protein
  • ( TIGR03269 ) methyl coenzyme M reductase system,
  • ( TIGR02211 ) lipoprotein releasing system, ATP-binding protein
  • ( TIGR02314 ) D-methionine ABC transporter, ATP-binding protein
  • ( TIGR01184 ) nitrate ABC transporter, ATP-binding proteins
  • ( TIGR01186 ) glycine betaine/L-proline transport ATP binding
  • ( TIGR01271 ) cystic fibrosis transmembrane conductor regulator
  • ( TIGR00960 ) Type II (General) Secretory Pathway
  • ( TIGR01188 ) daunorubicin resistance ABC transporter, ATP-binding
  • ( TIGR03005 ) ectoine/hydroxyectoine ABC transporter, ATP-binding protein
  • ( TIGR03258 ) 2-aminoethylphosphonate ABC transport system, ATP-binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00137850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000034089.997093137033517e-262locus:mrp-2 status:Confirmed
UniProt:Q20943 protein_id
:CCD69448.1
Tetrahymena borealisEI9_05850.19.997093137033517e-262ABC transporter (1245 aa)
DictyBaseDDB_G02876919.997093137033517e-262abcC3 on chromosome: 5 positio
n 792495 to 797051
SGDYGR281W1.9999565133760522e-166YOR1 Plasma membrane ATP-bindi
ng cassette (ABC) transporter,
multidrug transporter mediate
s export of many different org
anic anions including oligomyc
in; similar to human cystic fi
brosis transmembrane receptor
(CFTR)
OxytrichaContig841.0.g971.999765224767555e-159ABC transporter transmembrane
region
Stentor CoeruleusSteCoe_301121.1983630608508849e-70

General Information

Paragraph NoGene NameParagraph Text
28ABC2ABC2 shares homology with members of the ABC family transporter proteins. This protein appears to have two types of domains. It is thought that the two domains function together to bind ATP to transport substances such as glutathione, glucuronate, and sulfate across the membrane. Using energy from ATP hydrolysis, both domains of ABC transporters facilitate the transport of a wide variety of materials out of the cell. Paragraph by undergraduates from the Keck Science Department at Claremont McKenna and Scripps Colleges

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00137850(coding)
ATGGTTAGCGCAAAGGTGAAAATCAGTGAAGAACCTCCTTAAAAATAAACATAAAATGAT
TATAATTTAAATTTAGAAAACAGAGCTTCATTCATTAGTAAAGCTCTGTTTTTGTGGACC
AATAAAGTTATAAAATTGGGAAACTCTAAAATAATTAAAGAAAATGATTTATTTGATTTG
AGAGAAGAAGAAAGATTAGAAAAGGTTCTCTATGAACTGAAAAAAGCCTAATAAATTAAC
AAAAATAAAGGCTTTAGTTATGCAATTTTTAAAACTTGCTAGAAAGAATTCTTAATTACA
TCATTATTCACAATTCTTGTTTCTGGGCTTTCTTTTGCAGGCCCCATATTTTTAAACTTG
ATTATTAAAAATATTGCAGATCCGTTTTCTAATAAAAATGAAGGATATCTTTACTCAAGT
CTCCTTTTTGGGTGCTTTATATTAAAAGCCTTTTTGACACAACATTTAACGCTCTTAACT
AATAGAATAACATTTTAGAGTTGCAACTAAATTCTTGGTATAATGTACGAAAAATTACTC
AAATTGAGTAACACAGGAAGAAAATATATGGATCCTGGTAAAATGACGAATCTTGTTATC
ATGAATACAATGGAAATATTGCAATTTTTTTTATTCGCGTTTACAGCTTTGACTGCACCT
TTTATTATTATTGCAGCTTCTGTTTACATCATTTATGAACTTGACTATGTTGGTATTATA
GCCCCATTTATGCTTGCGCTTTCTGCTATTTTGGTTAATCACATTACTTCAAAGTAGGCT
GATTTTAGAATGAAAGTGTTCTCTATCATAGATCAAAGAAGTAAGAAAATTACTGAGTTT
TTTTAAGGTATTAAAATTATCAAATATTATGCCTGGGAAAAATGGGTTGTGAATTAATTA
TAGAATATTAGATTGAAAGAAATGAAAATTTTGTTTGGCTTCTTATTTAATATTGGATAA
GTTGATTGTATTAGTTAAGTTTCTCCCAGTATTATAGCTGTGCTCGTTTTTGTTATTTAT
ATTCTTTTAGATAATTAACTAAATGCAGCCAAGGCTTTCACAGCTCTTTCCCTTATAAAT
CTGCTTTAATCACCTATTATTCAACTTGTCTCTGGATGGGGTAAATTTATCTAAGCTAGG
GTTTCTTATAATCGTATAGCTCACTTTTTAGACTCAGAAGAATAACCTCAAGACTACTAT
GATGAAGAATTAATGAAAAATTGTGAATAAGGAGAAATAATGATAGAAGAAGGATTCTTT
AGTTGGGAAAGTGAAAAAAATGAAATGCACAATTTAAAAAATCCTGATGATGATTATATG
AAGAAAATGTAAATCAAATTTATTTAAAAAGAAATTTAGTCTAAGAAAAAAGCAAAAGAA
GATGTAAAATAATTGGAAGATGCTTTAGAAAATTTAAAATAAAAAAAAATCGCTGAAGTG
CCAAAAATTTCACCCAACTTAACATCAATAAATTTACATTATAAGCCTAACACTTTTAAT
GCTATTTATGGAATATTTTCTAGCGGAAAGACTACCCTTGCTCATGCTATCATCAACGAA
ATAAACAAGCTTTCAGGAAAAATCGCTGTTAAAGGTTCAATAGCTTATGTGCCTTAAATT
CCTTGGCTCAGATCATGCAGCTTGAGAGATAACATTTTATTTGGAGAGGAATATAATCAA
AAAAGATATGAAAAGACTCTCCGTATATGCTAACTATTGGATGATATTAAGTAATTACCA
GGTGGTGACTTAACTGAGATTGGTGAAAGAGGTGTAAATCTAAGTGGAGGATAAAAACAA
AGAATCAGTGTGGCTAGAGCAGTTTATTCTAATAGAGACATCTATGTTGTAGACGACTGT
CTTAGTGCTCTTGATAGTCATGTTGGTAGATTAATTTTTAAGAAGGTGTTTTACAAATTC
TTAAAGCAAAAAACAATTATTTTTATTACTCATCATACCCATTACATGAAGTATTTTGAT
ACAATTACTATCCTAAAAGAAGGAAAAGTAGCAGATTTTGGTTCTTACTCACAATTAACT
GCTAAAAATTCTGAAGCTTTATCTTACTTGCTTAATAATGAAAAGAGTTAAGTATAAAAG
GCAAAAGAAGGAGATGAGCTTGATGATCAAGAAGGATAAAATAATGAAATAAATGACGAA
TTGAGCTAAAATAATAAAATACCTCACAACCCTCCTCAATTAGGAAAAGCTTTTAGTGAG
TAACAATCACAGTTTTCAAAAATGTCAGAAGAAGCCTCTCAATTCACATAAAGTTAATGT
GAATAGCCCAATTAAGGACAAGATAAAGAGAATGAAGCAAAAGGTATGCTTGTTTAAAGT
GAAGAAAAAGCTGTAGGATCCGTTCCTTTTTTCGTTTACAAAGAATATTTCTTACTCGGA
GGATTAGGATATGTTACAATTGCATTGCTTATATTTGCAATTTCTTAAGCAGGATTAATG
TTGTCAGATTGGTGGTTAGGCTAATGGAGTTAAAATGCTTATACAGAATTAGATAATAAC
TAATATGCAGGAATTTATGCAGGAGTGAGCATAACAAGTGGTTTACTTTACATTTTCAGA
TATTTGGCTTTCTTAGTCTTTTCTATTAGAATATCAAAGAGTATATTTAGAAACCTTTTA
GTTAGACTGCTTTAAAGCCCAATGGAATTCTTTGATAAAACTCCACTAGGACGTATTGTG
ACTCGTTTCTCAAAAGATATAGACGCTATAGACTATATGTTACAATTGCTTCTATAATAA
CTAATTAGTGGTGTAATGACTCTTATTGGTAGTTTTGTTATGATTTCATTGATAACGCCT
ATATTCATTGCTGTAGCAGTTTTTATTTTAATTTGCTATTACTTTATTCTCAGGAGATAA
ATTAAATGCTCTCGTGAAATCAAAAGAATTGTTGATAATATTAGAGCACCTTTAATCGGT
GTTTACACAGAGCTAAATCAAGGCTTACTACAGATTAGGGGACTTAACAAAGAAAAATTT
TTTTTCAAAACATTTAGCAAATGTGTAGATGGACACACTAGATCCACTTTTAATGAATTT
TTCTGTAATCATTGGCTTAATCTTATTACTGATCTATTCTCTTCGATCATAGTCGCTGCT
TCTGCCTATTTAGGTTTAGCTTAAAAAGAAATTAATGGTTATGATATATAATTAGCTGCT
CATATTGGTTTGAGTTTAACATGGGCTTTAAGAATAAGTTCTTCTCTACCTGTAACAATA
AGGTTTGTCGGTGATACTGAGTTGTAAATGAACTCGTTCCATAGAATTTTAAACTATATC
AATGAAACACCATAAGAAAGAGATTTTGAAATTTTAAGTGAGACTAATTAAGCTAAAACT
CTAGAAAAATGGCCTTAATAAGGAGATCTAGAACTAGAAAATGTTTCTTACAGATACAGA
AAAGAAACACCGATAGTGTTAAAAAATATAACTCTTTCCATCAAAGCTAACGAAAAGATT
GGTGTTATTGGCAGAACCGGAAGTGGCAAATCAACATTAACCTTAGGATTACTTCGTATT
CTTGAATTAGTAGATGAAGAAAACAGTAAAATTCTATTGAATGGGTAAAATATTGCAAAA
ATAGGATTAAACTAATTAAGAAGTAATGTATCCATGATTCCTTAAGATCCTGTGCTATTT
TAGGGAACAATCAGGTCTAATGTAGACCCTTTTGAAATTTATACAGATACTCAGGTAGTT
GATGCTCTCAAAAAAGTCCAACTATGGGAAACATTACTAAGCAAGGCCAATCCAACTGAA
AATAAAGATAATTCACCAACACAAAACCCTAAAATTATAACAGCTGAAAATATTCAAACT
TAGACATTAATGAATGGAAGTGAATTAAATGAAAAGAGTATTAAAAATGTCTTAGATCTT
AAAGTAGATTCTCAAGGTGCAAATTTTTCTCAAGGAGAGAAGTAGTTGATAGCTCTTTCT
CGTGTTATTGTGAGAAAATGTAAGTTATTGCTTATGGATGAAGCTACTGCTAGTATTGAT
GAAAAAACTGATTGGATAATTCAAAATATGATAAGAAGCGAATTCTAAGAGACTACAATT
ATAACCATAGCACATCGTCTCAAAACAATTATTTAATATGATAGGATTTTAGTTTTAAGT
GATGGTGAAATTAAAGAATTTGATTCTCCAAAATCGATGCTTAACAACCCAAACAGCTAT
CTATTAAAGTTGATTAGAGAAAATGGTAAAGAACATGAAGCAGATATGAGAAGACTAGCA
TATAGCAATTGA


>TTHERM_00137850(protein)
MVSAKVKISEEPPQKQTQNDYNLNLENRASFISKALFLWTNKVIKLGNSKIIKENDLFDL
REEERLEKVLYELKKAQQINKNKGFSYAIFKTCQKEFLITSLFTILVSGLSFAGPIFLNL
IIKNIADPFSNKNEGYLYSSLLFGCFILKAFLTQHLTLLTNRITFQSCNQILGIMYEKLL
KLSNTGRKYMDPGKMTNLVIMNTMEILQFFLFAFTALTAPFIIIAASVYIIYELDYVGII
APFMLALSAILVNHITSKQADFRMKVFSIIDQRSKKITEFFQGIKIIKYYAWEKWVVNQL
QNIRLKEMKILFGFLFNIGQVDCISQVSPSIIAVLVFVIYILLDNQLNAAKAFTALSLIN
LLQSPIIQLVSGWGKFIQARVSYNRIAHFLDSEEQPQDYYDEELMKNCEQGEIMIEEGFF
SWESEKNEMHNLKNPDDDYMKKMQIKFIQKEIQSKKKAKEDVKQLEDALENLKQKKIAEV
PKISPNLTSINLHYKPNTFNAIYGIFSSGKTTLAHAIINEINKLSGKIAVKGSIAYVPQI
PWLRSCSLRDNILFGEEYNQKRYEKTLRICQLLDDIKQLPGGDLTEIGERGVNLSGGQKQ
RISVARAVYSNRDIYVVDDCLSALDSHVGRLIFKKVFYKFLKQKTIIFITHHTHYMKYFD
TITILKEGKVADFGSYSQLTAKNSEALSYLLNNEKSQVQKAKEGDELDDQEGQNNEINDE
LSQNNKIPHNPPQLGKAFSEQQSQFSKMSEEASQFTQSQCEQPNQGQDKENEAKGMLVQS
EEKAVGSVPFFVYKEYFLLGGLGYVTIALLIFAISQAGLMLSDWWLGQWSQNAYTELDNN
QYAGIYAGVSITSGLLYIFRYLAFLVFSIRISKSIFRNLLVRLLQSPMEFFDKTPLGRIV
TRFSKDIDAIDYMLQLLLQQLISGVMTLIGSFVMISLITPIFIAVAVFILICYYFILRRQ
IKCSREIKRIVDNIRAPLIGVYTELNQGLLQIRGLNKEKFFFKTFSKCVDGHTRSTFNEF
FCNHWLNLITDLFSSIIVAASAYLGLAQKEINGYDIQLAAHIGLSLTWALRISSSLPVTI
RFVGDTELQMNSFHRILNYINETPQERDFEILSETNQAKTLEKWPQQGDLELENVSYRYR
KETPIVLKNITLSIKANEKIGVIGRTGSGKSTLTLGLLRILELVDEENSKILLNGQNIAK
IGLNQLRSNVSMIPQDPVLFQGTIRSNVDPFEIYTDTQVVDALKKVQLWETLLSKANPTE
NKDNSPTQNPKIITAENIQTQTLMNGSELNEKSIKNVLDLKVDSQGANFSQGEKQLIALS
RVIVRKCKLLLMDEATASIDEKTDWIIQNMIRSEFQETTIITIAHRLKTIIQYDRILVLS
DGEIKEFDSPKSMLNNPNSYLLKLIRENGKEHEADMRRLAYSN


>TTHERM_00137850(gene)
ATGGTTAGCGCAAAGGTGAAAATCAGTGAAGAACCTCCTTAAAAATAAACATAAAATGAT
TATAATTTAAATTTAGAAAACAGAGCTTCATTCATTAGTAAAGCTCTGTTTTTGTGGACC
AATAAAGTTATAAAATTGGGAAACTCTAAAATAATTAAAGGTAAAAAAAATCTTAGAGTT
TTTATTCCAAAAATAATATAAATAAATAAATATAAATAGAAAATGATTTATTTGATTTGA
GAGAAGAAGAAAGATTAGAAAAGGTTCTCTATGAACTGAAAAAAGCCTAATAAATTAACA
AAAATGTATGTATTTATTGCATAAATTAGCTATTTGAGTTAATTTAACCCTTTTTTATTA
ACAGAAAGGCTTTAGTTATGCAATTTTTAAAACTTGCTAGAAAGAATTCTTAATTACATC
ATTATTCACAATTCTTGTTTCTGGGCTTTCTGTAAGTTAAATTGATACATAAAAAATAAT
CTTATGAAATTTAATAATTAATAGTTTGCAGGCCCCATATTTTTAAACTTGATTATTAAA
AATATTGCAGATCCGTTTTCTAATAAAAATGAAGGATATCTTTACTCAAGTCTCCTTTTT
GGGTGCTTTATATTAAAAGCCTTTTTGACACAACATTTAACGCTCTTAACTAATAGAATA
ACATTTTAGGTAATTAAAATTATATTTTTTACAAATAGAATGGATATAAAAACAAACAAA
CAAACAGAAAAATATTAATTTGCAAATAATCTCTTAAAATATTTTACTATTCACTATATT
TTTTTTTTAAAGTTTTTAATAGTTTCTTTTTATTAACTTTGTATGATTGATTCTACTTTA
ATCAAATTATATTTTTTTATCAAATTATTTAGAGTTGCAACTAAATTCTTGGTATAATGT
ACGAAAAATTACTCAAATTGAGTAACACAGGAAGAAAATATATGGATCCTGGTAAAATGA
CGAATCTTGTTATCATGAATACAATGGAAATATTGCAATTTTTTTTATTCGCGTTTACAG
CTTTGACTGCACCTTTTATTATTATTGCAGCTTCTGTTTACATCATTTATGAACTTGACT
ATGTTGGTATTATAGCCCCATGTAAAATTGTTAATTAAATATACACAAATTCAATCAATC
TATTAATATTAATTTAGTTATGCTTGCGCTTTCTGCTATTTTGGTTAATCACATTACTTC
AAAGTAGGCTGATTTTAGAATGAAAGTGTTCTCTATCATAGATCAAAGAAGTAAGAAAAT
TACTGAGTTTTTTTAAGGTATGTTTATAATTTTGTAATAAATCTTTATTTGCAATTATTC
TTATGAATAACATAGGTATTAAAATTATCAAATATTATGCCTGGGAAAAATGGGTTGTGA
ATTAATTATAGAATATTAGATTGAAAGAAATGAAAATTTTGTTTGGCTTCTTATTTAATA
TTGGATAAGTTGATTGTATTAGTTAAGTTTCTCCCAGTATTATAGCTGTGCTCGTTTTTG
TTATTTATATTCTTTTAGATAATTAACTAAATGCAGCCAAGGCTTTCACAGCTCTTTCCC
TTATAAATCTGCTTTAATCACCTATTATTCAACTTGTCTCTGGATGGGGTAAATTTATCT
AAGCTAGGGTTTCTTATAATCGTATAGCTCACTTTTTAGACTCAGAAGAATAACCTCAAG
ACTACTATGATGAAGAATTAATGAAAAATTGTGAATAAGGAGAAATAATGATAGAAGAAG
GATTCTTTAGTTGGGAAAGTGAAAAAAATGAAATGCACAATTTAAAAAATCCTGATGATG
ATTATATGAAGAAAATGTAAATCAAATTTATTTAAAAAGAAATTTAGTCTAAGAAAAAAG
CAAAAGAAGATGTAAAATAATTGGAAGATGCTTTAGAAAATTTAAAATAAAAAAAAATCG
CTGAAGTGCCAAAAATTTCACCCAACTTAACATCAATAAATTTACATTATAAGCCTAACA
CTTTTAATGCTATTTATGGAATATTTTCTAGCGGAAAGACTACCCTTGCTCATGCTATCA
TCAACGAAATAAACAAGCTTTCAGGAAAAATCGCTGTTAAAGGTTCAATAGCTTATGTGC
CTTAAATTGTAAAATGATAAATTTTACTTAAATCAATCAATTAATTATAAAATTCTTTTT
ATTTAAAAGCCTTGGCTCAGATCATGCAGCTTGAGAGATAACATTTTATTTGGAGAGGAA
TATAATCAAAAAAGATATGAAAAGACTCTCCGTATATGCTAACTATTGGATGATATTAAG
TAATTACCAGGTGGTGACTTAACTGAGATTGGTGAAAGAGGTGTAAATCTAAGTGGAGGA
TAAAAACAAAGAATCAGTGTGGCTAGAGCAGTTTATTCTAATAGAGACATCTATGTTGTA
GACGACTGTCTTAGTGCTCTTGATAGTCATGTTGGTAGATTAATTTTTAAGAAGGTGTTT
TACAAATTCTTAAAGCAAAAAACAATTATTTTTATTACTCATCATACCCATTACATGAAG
TATTTTGATACAATTACTATCCTAAAAGAAGGAAAAGTAGCAGATTTTGGTTCTTACTCA
CAATTAACTGCTAAAAATTCTGAAGCTTTATCTTACTTGCTTAATAATGAAAAGAGTTAA
GTATAAAAGGCAAAAGAAGGAGATGAGCTTGATGATCAAGAAGGATAAAATAATGAAATA
AATGACGAATTGAGCTAAAATAATAAAATACCTCACAACCCTCCTCAATTAGGAAAAGCT
TTTAGTGAGTAACAATCACAGTTTTCAAAAATGTCAGAAGAAGCCTCTCAATTCACATAA
AGTTAATGTGAATAGCCCAATTAAGGACAAGATAAAGAGAATGAAGCAAAAGGTATGCTT
GTTTAAAGTGAAGAAAAAGCTGTAGGATCCGTTCCTTTTTTCGTTTACAAAGAATATTTC
TTACTCGGAGGATTAGGATATGTTACAATTGCATTGCTTATATTTGCAATTTCTTAAGCA
GGATTAATGTAAATTACATTTTTATTTTAAGTTTCTCATTTTTTATTATGATGAACCAGG
TTGTCAGATTGGTGGTTAGGCTAATGGAGTTAAAATGCTTATACAGAATTAGATAATAAC
TAATATGCAGGAATTTATGCAGGTTTTTAAAAGAATTTTAGCAAAATTATTTCTTAATCT
TTATTTTTATTATTTAGGAGTGAGCATAACAAGTGGTTTACTTTACATTTTCAGATATTT
GGCTTTCTTAGTCTTTTCTATTAGAATATCAAAGAGTATATTTAGAAACCTTTTAGTTAG
ACTGCTTTAAAGCCCAATGGAATTCTTTGATAAAACTCCACTAGGACGTATTGTGACTCG
TTTCTCAAAAGATATAGACGCTATAGACTATATGTAAATAATAAAATTAATTTCAAGTTA
AAGATTCAAATCATTTATTTATTTATTTGTTTGTTTGTTTGATTTTATAGGTTACAATTG
CTTCTATAATAACTAATTAGTGGTGTAATGACTCTTATTGGTAGTTTTGTTATGATTTCA
TTGATAACGCCTATATTCATTGCTGTAGCAGTTTTTATTTTAATTTGCTATTACTTTATT
CTCAGGAGATAAATTAAATGCTCTCGTGAAATCAAAAGAATTGTTGATAATATTAGAGCA
CCTTTAATCGGTGTTTACACAGAGCTAAATCAAGGTAAGTTCTATTTAATTTATTAATAT
TTTAAAAACAACTTCTTAACAAATCAAATTTATTTTAATTTTTTATATAAAGGCTTACTA
CAGATTAGGGGACTTAACAAAGAAAAATTTTTTTTCAAAACATTTAGCAAATGTGTAGAT
GGACACACTAGATCCACTTTTAATGAATTTTTCTGTAATCATTGGCTTAATCTTATTACT
GATCTATTCTCTTCGATCATAGTCGCTGCTTCTGCCTATTTAGGTTTAGCTTAAAAAGAA
ATTAATGGTTATGATATATAATTAGCTGCTCATATTGGTAAAATTATCTCATTTAATTTA
AATCTAAAATTTAATTTGATATTTTTTGATTAGGTTTGAGTTTAACATGGGCTTTAAGAA
TAAGTTCTTCTCTACCTGTAACAATAAGGTTTGTCGGTGATACTGAGTTGTAAATGAACT
CGTTCCATAGAATTTTAAACTATATCAATGAAACACCATAAGAAAGAGATTTTGAAATTT
TAAGTGAGACTAATTAAGCTAAAACTCTAGAAAAATGGCCTTAATAAGGAGATCTAGAAC
TAGAAAATGTTTCTTACAGATACAGAAAAGAAACACCGATAGTGTTAAAAAATATAACTC
TTTCCATCAAAGCTAACGAAAAGGTACTCTAATAAAAAGTTATATAGTATTTATAAATTT
TTCTTAAATAAAGATTGGTGTTATTGGCAGAACCGGAAGTGGCAAATCAACATTAACCTT
AGGATTACTTCGTATTCTTGAATTAGTAGATGAAGTAAATAAAACTTATAGCATAATTTT
TTGGAATTTTTCTTATTTTTTACTGAAAAATAAAAAAAATAGGAAAACAGTAAAATTCTA
TTGAATGGGTAAAATATTGCAAAAATAGGATTAAACTAATTAAGAAGTAATGTATCCATG
ATTCCTTAAGATCCTGTGCTATTTTAGGGAACAATCAGGTCTAATGTAGACCCTTTTGAA
ATTTATACAGATACTCAGGTAGTTGATGCTCTCAAAAAAGTCCAACTATGGGAAACATTA
CTAAGCAAGGCCAATCCAACTGAAAATAAAGATAATTCACCAACACAAAACCCTAAAATT
ATAACAGCTGAAAATATTCAAACTTAGACATTAATGAATGGAAGTGAATTAAATGAAAAG
AGTATTAAAAGTATTTACTATTTATTTAATCACTTAATTATTCATTAAGCTTAATTTAAA
TTAATTTAGATGTCTTAGATCTTAAAGTAGATTCTCAAGGTGCAAATTTTTCTCAAGGAG
AGAAGTAGTTGATAGCTCTTTCTCGTGTTATTGTGGTAAACTAAAGAAATTCAAAACAAA
TTTTAAAAATACTTATCTAAAAAATAGAGAAAATGTAAGTTATTGCTTATGGATGAAGCT
ACTGCTAGTATTGATGAAAAAACTGATTGGATAATTCAAAATATGATAAGAAGCGAATTC
TAAGAGACTACAATTATAACCATAGCACATCGTCTCAAAACAATTATTTAATATGATAGG
ATTTTAGTTTTAAGTGATGGTGAAATTAAAGAATTTGATTCTCCAAAATCGATGCTTAAC
AACCCAAACAGTAAATAAAGATATCTATTGAAAAGTATAATTAAATAATTTTTTTAAAAA
TAGGCTATCTATTAAAGTTGATTAGAGAAAATGGTAAAGAACATGAAGCAGATATGAGAA
GACTAGCATATAGCAATTGA