Identifiers and Description

Gene Model Identifier

TTHERM_01020700

Standard Name

ABC1 (Fusion of aarF domain containing protein and ubiquinone biosynthesis protein.)

Aliases

PreTt17637 | 200.m00050 | 3756.m00246

Description

Fusion of aarF domain containing protein and ubiquinone biosynthesis protein. ABC1 family protein. Sequence similarity to the ABC1 protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 21.8%

TetraMine Data

TTHERM_01020700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19285.19.997093137033517e-262ABC1 family protein (763 aa)
OxytrichaContig21891.0.g83.999369102302453e-125ABC1 family
WormBaseWBGene000084106.001309080488961e-82status:Confirmed UniProt:O17
735 protein_id:CAB02876.1
DictyBaseDDB_G02848979.996907204735647e-62abkD on chromosome: 4 position
2611033 to 2613269
SGDYLR253W7.999270105144775e-57YLR253W Putative protein of un
known function; the authentic,
non-tagged protein is detecte
d in highly purified mitochond
ria in high-throughput studies
; transcription is periodic du
ring the metabolic cycle; YLR2
53W is not an essential gene
Stentor CoeruleusSteCoe_76777.781132241133797e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01020700(coding)
ATGAATTTTATTAGGAGAAATAAGTTTAAAATTTTAGGTACTGCACTAATCTCTCCTTTC
GCATTAGTTTATGGTGCAGGCTTTTATTATTTTCCAGAATTAAGACATAATTAAAGTTAA
ATGATTAAAGCTTTAATACGTACAGGTAGAGTAGCTATAGCAGGAGCAAGAATGGCAAAT
ATATATATGAAAGATGATAATCGAAGCATCGAGACAAAACACAATGAAGCCTCATTGATT
TTAAAAGATGCTTTTGTAAAAAATGCTGGACTATACTTAAAATTTGCATAATTACTATCA
TCACTCGATGTTGTTGTACCAGAAGAATATAGAAGAAATTTTGAACCATTGTGTCATGAG
TGTCCAGAAAATAGTTTTTAAAATGTAAAACATTCAATAGAAAGCTCATTAAGAAAACCA
ATAGATGAGGTATTTTCAGAGTTTAATCCAAAGCCACTAAAATCGGCATCTATTGCTTAA
GTTCATGAGGCCGTTTTAAAAGAAACAGGTGAGAGAGTTGCTGTTAAGGTGATGCATGAC
TGGTTGTAAGAATCTAGTAAAGGAGATTTAAAAGTAATAGGTCTATTTGTTGATATAGGA
GAATTATTATTTCCAGAATTTAAATTCAAGTGGTTTTCAGAAGAATTAAATTAAATTCTA
CCTCAAGAATTAAACTTCTTGGATGAAGTTAAAAACAGTGAGAGAGCCAGATAAATATTG
AAAGATAAACCTAACATTTATGTTCCTATAAACCACTTTGGCCTTTGCAATAGTAAAATA
ATTACTATGGAATTTATTGATGGATTCCCAATTATGGATGTGCCAACTCTGAAGAGAGAA
AAATTTGACATGAAAAAAATTGCCTATACAATAAGTGATACATTTTCTTAAATGATATTT
TAAAATGGATTTGTTCATAGCGATCCTCATTAAGGAAATCTTTTATTAAGGAAAGTAAAA
GATCCTAAAAACCCTCACAAAACCATAGACCAAGTTGTTCTTTTGGATCATGGGTTATAT
AAAAATCTATCTCCATAGTTTAGATTGAGTTATAGCAAACTTTGGAAAGGTATAATAACT
CAAAACGAAGAACTTATCTAAAAGTCTTCAATCGAGTTAGGTGTTAAAGAAGATTAATAC
CCTCTCTTTGCCTCTATGATTACTAGCAGAACATACGAAGATTTGATGGATGATAAAAAA
TCTGTAAAAGAGCGTTTAAGAAGTCCTTAAAACTAAGAAGAAAGAGATAAAATAGCAATA
AATGCAGCCAAATACCATAGATAGATTATTTAAATATTACACCAAATGAACAGATCTCTG
CTACTCTTATTAAAAACAACTGATTTCTTAAGGACTATAGACAACAAATTAGGAAGCCCA
GTAAATACCTTTGAAATAACACTTGACTATTGCTTTAATGAAATAGAAAAATTCGAATTC
AATAATTCTTTTTGGCTATTTTTACTCTTTAGATTTGAAAAAATAATGGCTAAGATTAAA
TTATTTATTTATAAATAATTATTACCTTAACCTTAATTAAATTGA


>TTHERM_01020700(protein)
MNFIRRNKFKILGTALISPFALVYGAGFYYFPELRHNQSQMIKALIRTGRVAIAGARMAN
IYMKDDNRSIETKHNEASLILKDAFVKNAGLYLKFAQLLSSLDVVVPEEYRRNFEPLCHE
CPENSFQNVKHSIESSLRKPIDEVFSEFNPKPLKSASIAQVHEAVLKETGERVAVKVMHD
WLQESSKGDLKVIGLFVDIGELLFPEFKFKWFSEELNQILPQELNFLDEVKNSERARQIL
KDKPNIYVPINHFGLCNSKIITMEFIDGFPIMDVPTLKREKFDMKKIAYTISDTFSQMIF
QNGFVHSDPHQGNLLLRKVKDPKNPHKTIDQVVLLDHGLYKNLSPQFRLSYSKLWKGIIT
QNEELIQKSSIELGVKEDQYPLFASMITSRTYEDLMDDKKSVKERLRSPQNQEERDKIAI
NAAKYHRQIIQILHQMNRSLLLLLKTTDFLRTIDNKLGSPVNTFEITLDYCFNEIEKFEF
NNSFWLFLLFRFEKIMAKIKLFIYKQLLPQPQLN


>TTHERM_01020700(gene)
ATTAATAAAGATATATTAAGACTGATATCAATTCCTTTAAATCAAACTTTTTTAAAGTCA
AGCATGAATTTTATTAGGAGAAATAAGTTTAAAATTTTAGGTACTGCACTAATCTCTCCT
TTCGCATTAGTTTATGGTGCAGGCTTTTATTATTTTCCAGAATTAAGACATAATTAAAGT
TAAATGATTAAAGCTTTAATACGTACAGGTAGAGTAGCTATAGCAGGAGCAAGAATGGCA
AATATATATATGAAAGTATGAATATCATCAAAATATTAAGTTAAAATAATTTTATTTATT
TGCTAGGATGATAATCGAAGCATCGAGACAAAACACAATGAAGCCTCATTGATTTTAAAA
GATGCTTTTGTAAAAAATGCTGGACTATACTTAAAATTTGCATAATTACTATCATCAGTA
ATTTTATCTTTTGCAAGAGAGATATGATAAAATATTTTTTTTCCATTTAATTATTTATAA
TTAAAAAGCTCGATGTTGTTGTACCAGAAGAATATAGAAGAAATTTTGAACCATTGTGTC
ATGAGTGTCCAGAAAATAGTTTTTAAAATGTAAAACATTCAATAGAAAGCTCATTAAGAA
AACCAATAGATGAGGTATTTTCAGGTAAAAGCTAAAAATATATCGAATAGAAATATTCAA
TGTTATTTTATTTATAGAGTTTAATCCAAAGCCACTAAAATCGGCATCTATTGCTTAAGT
TCATGAGGCCGTTTTAAAAGAAACAGGTGAGAGAGTTGCTGTTAAGGTGATGCATGACTG
GTTGTAAGAATCTAGTAAAGGAGATTTAAAAGTAATAGGTCTATTTGTTGATATAGGAGA
ATTATTATTTCCAGAATTTAAATTCAAGTGGTTTTCAGAAGAATTAAGTATTTTTATTAT
ATAAATAAAACATTTCTTTATATTTCAAATGAAAAGCTGGACATTTCTTTCTTATAATTA
TCCAATTGGTATATTGTAAATTCTAGTTAAACTGATTAATATTTTAATTAAAATAGATTA
AATTCTACCTCAAGAATTAAACTTCTTGGATGAAGTTAAAAACAGTGAGAGAGCCAGATA
AATATTGAAAGATAAACCTAACATTTATGTTCCTATAAACCACTTTGGCCTTTGCAATAG
TAAAATAATTACTATGGAATTTATTGATGGATTCCCAATTATGGATGTGCCAACTCTGAA
GAGAGAAAAATTTGACATGAAAAAAATTGCCTATACAATAAGTGATACATTTTCTTAAAT
GATATTTTAAAATGGATTTGTTCATAGCGATCCTCATTAAGGAAATCTTTTATTAAGGAA
AGTAAAAGATCCTAAAAACCCTCACAAAACCATAGACCAAGTTGTTCTTTTGGATCATGG
GTTATATAAAAATCTATCTCCATAGTTTAGATTGAGTTATAGCAAACTTTGGAAAGGTAT
AATAACTCAAAACGAAGAACTTATCTAAAAGTCTTCAATCGAGTTAGGTGTTAAAGAAGA
TTAATACCCTCTCTTTGCCTCTATGATTACTAGCAGAACATACGAAGATTTGATGGATGA
TAAAAAATCTGTAAAAGAGCGTTTAAGAAGTCCTTAAAACTAAGAAGAAAGAGATAAAAT
AGCAATAAATGCAGCCAAATACCATAGATAGATTATTTAAATATTACACCAAATGAACAG
GTAAAGTTGAATCTATAAACAAGTTAAAAATAATTTTTATTTAAAAAGATCTCTGCTACT
CTTATTAAAAACAACTGATTTCTTAAGGACTATAGACAACAAATTAGGAAGCCCAGTAAA
TACCTTTGAAATAACAGTAATTTATTGATTTTTAATCATAATAATTTAAAATAAAACATT
TTTATGAATAACAGCTTGACTATTGCTTTAATGAAATAGAAAAATTCGAATTCAATAATT
CTTTTTGGCTATTTTTACTCTTTAGATTTGAAAAAATAATGGCTAAGATTAAATTATTTA
TTTATAAATAATTATTACCTTAACCTTAATTAAATTGATACTTATTTTCATATATAAAAT
CACTGAAATAAAAATTTTTGTATATAGCAATTT