Identifiers and Description

Gene Model Identifier

TTHERM_00145290

Standard Name

AAP6 (Ada2-associated protein 6)

Aliases

PreTt26737 | 11.m00434 | 3702.m00156 | A2A6

Description

Member of the SAGA complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00145290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04741.19.997093137033517e-262hypothetical protein (1505 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00145290(coding)
ATGCTCCAGTAGTATTAAAATTAATAGTAATCATAGGTACCATAGAGCCAAAGACAAAGT
AGAAGAAGTTCTTCTAACTTTAACCTTAAAGATGATATAAGTAGCCAAAGTAACAAAGGA
GAGTTTACTTAAGGCTCTACTTTTGGAATTTATGACTAGAAAAGCGATAATCTAATTAAC
AATAGTTTAAATTCATAGCAAGAAAATCAAGGCAAAATGCTGTTTTAAAATATTTAGATA
GATTAAGCAGATTAAAGTAAAAATGCTGCATTAATAAAAAGTAGATAATAAAGTAGTAGT
GAAAATAACAGTAATAATTAACAAAGTTAGACTACAGATCAAATTAGAGTAATTATAGAT
AGCTAATAAAAAGCATTAGATTAAACCACAAATTCAAGCTAAGGAAGTTAAAATATAGTA
AATGCAGTTGGTCAAGAGTATTTGAAACGTTTTGAAAATGAAAGTTAAGAATAATAATTA
TCAAAAAACAATAAATTATGTAATGCAATATCTAAGGATATTAAGGCAAATTATGATTAG
CATTTTTTAAGCTAGACTTAAGTATTAGAAAATTAAGAAAGCAGCAATAATTAACAAATA
AATAAGTATAGTCAATAGTAGGAAGTAGTAGATTTTAAAATGGACATAGAAGAAACAGAT
AACTAATTATAGTAAAAGTAATTGATAGAAAATTATGGAGAAGAGGAAGAATGTTAATAG
TATGATAATGAAAATAAGGAAGAAGAACTTGATGAAGAAGAAAATTAATTTGCCTATAAA
AAGGGAAAGTTTTTGAAGAAAAGCAAAAAGCCAAGTAATGATATAAATACAAATGTAAAA
ACTAGGTCGAAGTTAGGAAATAAGACAACTAATAAAAAGGATTAAAAAAATAATAAAGCT
TAAAATAATATTTAAAAAGCAGAGAACTCTAAGATTAACACTACTCAAACTCATTCTAAA
ACAGCAGGTAAAGGAGAAGCTTACTTCAATAGAACATATAGAGGAAATAATAATACAACC
CATGGTGGTTTATCTAAAATGAATACATCTGGAAACGAGATAGCTAATGCTGTCATAAAA
GATGAAATTGTTGAATAGAATAAAGCAGAAAATTTGGACACATTAGTAAATTCCTTACAG
TTTTAAAGATAAAGCTCATAGTAATTATTCTCAAGTGATACTCAAAAACCTTGTTAAAGT
TACTTAGCATAGCTTAGTTTTTAAAATAAATAGCAGAATATTTCAGACAATTAGCAAACT
TATAACAAGGAGAACGATTGTTCTAATAAAATAGACAACAAGTAATATAATTAGGATGCT
TAAAGAAATTAACAGTAAATAAATTTGGTTCCTACTTTCTAATAAAGTGGTAGAAAGTAT
TTAAAAAGAGTTATTGATAAAATTGTATTAGATTTCAGATCGAATTAGGATCTATAGCAG
CAATCACTTAAAGAATTAGCAATTACTCTTAACGACTTATTTTCATAAGTCAATGAATTA
CATTTAAAAATACCTGATAATTAAGATTGGAACAACCTCATTACTCTTGAGTTCAGTACA
TGTATGCCAATAGTCCTTGACGTGAGAATAGATCCAATATGCTTCTAAAAAGTAGCTTTC
ACAAATATGAATAAAGAGATTTAGACTGCCTTTCGTAAGCTTAAATTTGGAGATAGATTA
AAAGATAATCCTAACACTTAACAAATTTAAGAGGAAATTCAAAATTGGTTTTGCCCTGAA
AAAGATTTCGTGTGCAAAAAGAGCTTGGTTAAAGAGAATTATTTGTAAAGTCAAGAAATA
AATTAAAATTTAGAGTAACTTGAATTTGAAAACTATAGATACCAACAAATATTTTTCAAA
TCTTCTCTGCACTCATTTTGCAGCATATGTCAAAATCAAGCTAGTGAATAACATTATCTA
CAAGCTAATACTTAAGGATTATACTTTTGCTATTCTCAAAAAGATATATTAATTTAAGAC
TTTATTGAATTTTTAGACAAAGTTTAAATTAATCTCTAAAATCAATACTCTTAGATATTC
AACGAAGGAGAAATTAGAGAAAATTTATGCTCTAACTAGTAATTATATCTTTTCTAGCAT
TTTAAGAATAGGGAATTTACAAATTATAATGGAGATTAAGCTATTAGAGATTTTAAATTG
TAGTAAATTAGTGAATAAAAAATATAAAATAAATCTGAAGATGATTTTATTTAAACTCCA
GTTTAAACAAAAAATCCTAATCAGCTTCCTTAATCTATGAATAGAAATAGCCAAAGTTAA
GAATAATATTTAAATTACAGTACTCCTGTGACATAACCTTTTAAATTTTAAAATTCTAAT
TTTTATCAAGAGCAGCAGTTATAAAAATAGTTTCAAATCAACTCTATGAACAATAACAAA
ATCAATCATCATATGCAGAGCTATTATGTAAGCTAAGAAGATTTTAAATATAATAATTTT
CATAAAAAATTAGAGAGAGCCCTTAAATTAAAGCTTATAGAGTCTGTTACTATAAGATTC
TGTTTCTAGGAATATTACTATGAAGAGTAATATGAACTTGTTTAAAAAATTTATAATATA
ATAAAAATAATTTCGTAGAGAATAAACATAAATAAACTTTATTTAAGTGTTAATCAAGGA
ATTTCTCCTCTTATACTTTCATAAATAATTTTTGTTGAAGAGCTTAACATTGATTTAATA
GAGGCTGGAAGTTGCTTGAAGGATAAAAATGTATTTTATTTAAACTTAAGAAAACCTAAA
TACTAAATCCTTAAACATGACCTTTAAATATTTGCATAAATAGTAAATTAGAATGCTTCC
TTTGAAGAGATTCATATTAATTTTGATGAAAAATAAAAAACGTGCATTTAAAGCATTTCT
CATCTACTAACAAGGTATAGATAAGAAATAAACTTAAAAGAGTAAACACTTACTATTTTT
AGAGAAAATCTTCCTCCTATTTAGGAATTTCCTTCTTCAGTATGTGAATATTTAGATATA
ATAGACGAATCAGGAAATTTTAATGATAAAGAAGTAGAGCAAGAAGAAGAAGAAACAGAT
TTAGTTTCAAACAAATATTCTTAATCTCCTGAGATCTATAATAAATATTCAAATTATGAT
GATTTAGGATAAGAAGAAAATAGCGTAGACAGTTAAAATTCTTCTGAAAAAAATATTTTA
GATACTAAATAAGAAAATGATTAATTTATTTAAAACATACATTGCCTTAGTGAAAAAAAT
CCATTTGACTCAGTCATTGATAGTAATAAAAATAATATAATCATTAATTTAATTTAAAAT
GAATAAAATAACATTGAAGTTTAGAAACTAAGCTAAAATAATATAAGTTTATAACTCAAA
GAAGTAGAAGAATAAACACCAAAATTTATATCAAGTTAAATAGAAACTGAAAAATAGAGC
CAAAAAATTGAAGTAGAAGAATAGTTAATCGAATAGGAATCCTAATAGGTCGAAACTGAT
GTTACATAAAATTTGAGCGTTTCAAAAAAACGTGAGAGAAAAAGATAACCTAAAAAAAAG
GCTGACTTAAATTTAGAATAAAAATAATCTATTTCAGAAAAGGCTATCAGCAAAAAGAGG
AATTAAGATAAAGATGAAAAAAGATAGTAGAAAAGCAAAAATTAGAAAGTGAATGCTAAA
TAAAAAAAGGGTAAAGATAATGAACAAACAATCAAAAATTTAAATTCCGAAAATGAGTAA
GATTAAAAGTCCTCTTCAATAAATGAATAGCAAGACGATGAAAGCAAAGAAGCTTTGACA
AACTTGGAAACTAATCAGATTAATTCTCCTAATAATAGCAATAACAGTACTAACTCGAAA
GGAGATCAATATCTTAACATCAAAGGCAAGCAGTAAATTTTGAAATAAGATTAAAACCCT
TAATAGTTACTTTACTGA


>TTHERM_00145290(protein)
MLQQYQNQQQSQVPQSQRQSRRSSSNFNLKDDISSQSNKGEFTQGSTFGIYDQKSDNLIN
NSLNSQQENQGKMLFQNIQIDQADQSKNAALIKSRQQSSSENNSNNQQSQTTDQIRVIID
SQQKALDQTTNSSQGSQNIVNAVGQEYLKRFENESQEQQLSKNNKLCNAISKDIKANYDQ
HFLSQTQVLENQESSNNQQINKYSQQQEVVDFKMDIEETDNQLQQKQLIENYGEEEECQQ
YDNENKEEELDEEENQFAYKKGKFLKKSKKPSNDINTNVKTRSKLGNKTTNKKDQKNNKA
QNNIQKAENSKINTTQTHSKTAGKGEAYFNRTYRGNNNTTHGGLSKMNTSGNEIANAVIK
DEIVEQNKAENLDTLVNSLQFQRQSSQQLFSSDTQKPCQSYLAQLSFQNKQQNISDNQQT
YNKENDCSNKIDNKQYNQDAQRNQQQINLVPTFQQSGRKYLKRVIDKIVLDFRSNQDLQQ
QSLKELAITLNDLFSQVNELHLKIPDNQDWNNLITLEFSTCMPIVLDVRIDPICFQKVAF
TNMNKEIQTAFRKLKFGDRLKDNPNTQQIQEEIQNWFCPEKDFVCKKSLVKENYLQSQEI
NQNLEQLEFENYRYQQIFFKSSLHSFCSICQNQASEQHYLQANTQGLYFCYSQKDILIQD
FIEFLDKVQINLQNQYSQIFNEGEIRENLCSNQQLYLFQHFKNREFTNYNGDQAIRDFKL
QQISEQKIQNKSEDDFIQTPVQTKNPNQLPQSMNRNSQSQEQYLNYSTPVTQPFKFQNSN
FYQEQQLQKQFQINSMNNNKINHHMQSYYVSQEDFKYNNFHKKLERALKLKLIESVTIRF
CFQEYYYEEQYELVQKIYNIIKIISQRININKLYLSVNQGISPLILSQIIFVEELNIDLI
EAGSCLKDKNVFYLNLRKPKYQILKHDLQIFAQIVNQNASFEEIHINFDEKQKTCIQSIS
HLLTRYRQEINLKEQTLTIFRENLPPIQEFPSSVCEYLDIIDESGNFNDKEVEQEEEETD
LVSNKYSQSPEIYNKYSNYDDLGQEENSVDSQNSSEKNILDTKQENDQFIQNIHCLSEKN
PFDSVIDSNKNNIIINLIQNEQNNIEVQKLSQNNISLQLKEVEEQTPKFISSQIETEKQS
QKIEVEEQLIEQESQQVETDVTQNLSVSKKRERKRQPKKKADLNLEQKQSISEKAISKKR
NQDKDEKRQQKSKNQKVNAKQKKGKDNEQTIKNLNSENEQDQKSSSINEQQDDESKEALT
NLETNQINSPNNSNNSTNSKGDQYLNIKGKQQILKQDQNPQQLLY


>TTHERM_00145290(gene)
ATGCTCCAGTAGTATTAAGTAAGAATACTCAAAGTAGGGAAATTAATAAATTTTATAGAA
TTAATAGTAATCATAGGTACCATAGAGCCAAAGACAAAGTAGAAGAAGTTCTTCTAACTT
TAACCTTAAAGATGATATAAGTAGCCAAAGTAACAAAGGAGAGTTTACTTAAGGCTCTAC
TTTTGGAATTTATGACTAGAAAAGCGATAATCTAATTAACAATAGTTTAAATTCATAGCA
AGAAAATCAAGGCAAAATGCTGTTTTAAAATATTTAGATAGATTAAGCAGATTAAAGTAA
AAATGCTGCATTAATAAAAAGTAGATAATAAAGTAGTAGTGAAAATAACAGTAATAATTA
ACAAAGTTAGACTACAGATCAAATTAGAGTAATTATAGATAGCTAATAAAAAGCATTAGA
TTAAACCACAAATTCAAGCTAAGGAAGTTAAAATATAGTAAATGCAGTTGGTCAAGAGTA
TTTGAAACGTTTTGAAAATGAAAGTTAAGAATAATAATTATCAAAAAACAATAAATTATG
TAATGCAATATCTAAGGATATTAAGGCAAATTATGATTAGCATTTTTTAAGCTAGACTTA
AGTATTAGAAAATTAAGAAAGCAGCAATAATTAACAAATAAATAAGTATAGTCAATAGTA
GGAAGTAGTAGATTTTAAAATGGACATAGAAGAAACAGATAACTAATTATAGTAAAAGTA
ATTGATAGAAAATTATGGAGAAGAGGAAGAATGTTAATAGTATGATAATGAAAATAAGGA
AGAAGAACTTGATGAAGAAGAAAATTAATTTGCCTATAAAAAGGGAAAGTTTTTGAAGAA
AAGCAAAAAGCCAAGTAATGATATAAATACAAATGTAAAAACTAGGTCGAAGTTAGGAAA
TAAGACAACTAATAAAAAGGATTAAAAAAATAATAAAGCTTAAAATAATATTTAAAAAGC
AGAGAACTCTAAGATTAACACTACTCAAACTCATTCTAAAACAGCAGGTAAAGGAGAAGC
TTACTTCAATAGAACATATAGAGGAAATAATAATACAACCCATGGTGGTTTATCTAAAAT
GAATACATCTGGAAACGAGATAGCTAATGCTGTCATAAAAGATGAAATTGTTGAATAGAA
TAAAGCAGAAAATTTGGACACATTAGTAAATTCCTTACAGTTTTAAAGATAAAGCTCATA
GTAATTATTCTCAAGTGATACTCAAAAACCTTGTTAAAGTTACTTAGCATAGCTTAGTTT
TTAAAATAAATAGCAGAATATTTCAGACAATTAGCAAACTTATAACAAGGAGAACGATTG
TTCTAATAAAATAGACAACAAGTAATATAATTAGGATGCTTAAAGAAATTAACAGTAAAT
AAATTTGGTTCCTACTTTCTAATAAAGTGGTAGAAAGTATTTAAAAAGAGTTATTGATAA
AATTGTATTAGATTTCAGATCGAATTAGGATCTATAGCAGCAATCACTTAAAGAATTAGC
AATTACTCTTAACGACTTATTTTCATAAGTCAATGAATTACATTTAAAAATACCTGATAA
TTAAGATTGGAACAACCTCATTACTCTTGAGTTCAGTACATGTATGCCAATAGTCCTTGA
CGTGAGAATAGATCCAATATGCTTCTAAAAAGTAGCTTTCACAAATATGAATAAAGAGAT
TTAGACTGCCTTTCGTAAGCTTAAATTTGGAGATAGATTAAAAGATAATCCTAACACTTA
ACAAATTTAAGAGGAAATTCAAAATTGGTTTTGCCCTGAAAAAGATTTCGTGTGCAAAAA
GAGCTTGGTTAAAGAGAATTATTTGTAAAGTCAAGAAATAAATTAAAATTTAGAGTAACT
TGAATTTGAAAACTATAGATACCAACAAATATTTTTCAAATCTTCTCTGCACTCATTTTG
CAGCATATGTCAAAATCAAGCTAGTGAATAACATTATCTACAAGCTAATACTTAAGGATT
ATACTTTTGCTATTCTCAAAAAGATATATTAATTTAAGACTTTATTGAATTTTTAGACAA
AGTTTAAATTAATCTCTAAAATCAATACTCTTAGATATTCAACGAAGGAGAAATTAGAGA
AAATTTATGCTCTAACTAGTAATTATATCTTTTCTAGCATTTTAAGAATAGGGAATTTAC
AAATTATAATGGAGATTAAGCTATTAGAGATTTTAAATTGTAGTAAATTAGTGAATAAAA
AATATAAAATAAATCTGAAGATGATTTTATTTAAACTCCAGTTTAAACAAAAAATCCTAA
TCAGCTTCCTTAATCTATGAATAGAAATAGCCAAAGTTAAGAATAATATTTAAATTACAG
TACTCCTGTGACATAACCTTTTAAATTTTAAAATTCTAATTTTTATCAAGAGCAGCAGTT
ATAAAAATAGTTTCAAATCAACTCTATGAACAATAACAAAATCAATCATCATATGCAGAG
CTATTATGTAAGCTAAGAAGATTTTAAATATAATAATTTTCATAAAAAATTAGAGAGAGC
CCTTAAATTAAAGCTTATAGAGTCTGTTACTATAAGATTCTGTTTCTAGGAATATTACTA
TGAAGAGTAATATGAACTTGTTTAAAAAATTTATAATATAATAAAAATAATTTCGTAGAG
AATAAACATAAATAAACTTTATTTAAGTGTTAATCAAGGAATTTCTCCTCTTATACTTTC
ATAAATAATTTTTGTTGAAGAGCTTAACATTGATTTAATAGAGGCTGGAAGTTGCTTGAA
GGATAAAAATGTATTTTATTTAAACTTAAGAAAACCTAAATACTAAATCCTTAAACATGA
CCTTTAAATATTTGCATAAATAGTAAATTAGAATGCTTCCTTTGAAGAGATTCATATTAA
TTTTGATGAAAAATAAAAAACGTGCATTTAAAGCATTTCTCATCTACTAACAAGGTATAG
ATAAGAAATAAACTTAAAAGAGTAAACACTTACTATTTTTAGAGAAAATCTTCCTCCTAT
TTAGGAATTTCCTTCTTCAGTATGTGAATATTTAGATATAATAGACGAATCAGGAAATTT
TAATGATAAAGAAGTAGAGCAAGAAGAAGAAGAAACAGATTTAGTTTCAAACAAATATTC
TTAATCTCCTGAGATCTATAATAAATATTCAAATTATGATGATTTAGGATAAGAAGAAAA
TAGCGTAGACAGTTAAAATTCTTCTGAAAAAAATATTTTAGATACTAAATAAGAAAATGA
TTAATTTATTTAAAACATACATTGCCTTAGTGAAAAAAATCCATTTGACTCAGTCATTGA
TAGTAATAAAAATAATATAATCATTAATTTAATTTAAAATGAATAAAATAACATTGAAGT
TTAGAAACTAAGCTAAAATAATATAAGTTTATAACTCAAAGAAGTAGAAGAATAAACACC
AAAATTTATATCAAGTTAAATAGAAACTGAAAAATAGAGCCAAAAAATTGAAGTAGAAGA
ATAGTTAATCGAATAGGAATCCTAATAGGTCGAAACTGATGTTACATAAAATTTGAGCGT
TTCAAAAAAACGTGAGAGAAAAAGATAACCTAAAAAAAAGGCTGACTTAAATTTAGAATA
AAAATAATCTATTTCAGAAAAGGCTATCAGCAAAAAGAGGAATTAAGATAAAGATGAAAA
AAGATAGTAGAAAAGCAAAAATTAGAAAGTGAATGCTAAATAAAAAAAGGGTAAAGATAA
TGAACAAACAATCAAAAATTTAAATTCCGAAAATGAGTAAGATTAAAAGTCCTCTTCAAT
AAATGAATAGCAAGACGATGAAAGCAAAGAAGCTTTGACAAACTTGGAAACTAATCAGAT
TAATTCTCCTAATAATAGCAATAACAGTACTAACTCGAAAGGAGATCAATATCTTAACAT
CAAAGGCAAGCAGTAAATTTTGAAATAAGATTAAAACCCTTAATAGTTACTTTACTGA