Identifiers and Description

Gene Model Identifier

TTHERM_00464970

Standard Name

AAP5 (Ada2-associated protein 5)

Aliases

PreTt18600 | 55.m00155 | 3710.m00006 | A2A5

Description

Member of the SAGA complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00633 ) Helix-hairpin-helix motif
  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00464970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14751.19.997093137033517e-262hypothetical protein (1165 aa)
OxytrichaContig442.1.g23.9983110956465888e-22Zinc-finger domain of monoamin
e-oxidase A repressor R1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10
  2. Ref:27892853: Hamilton EP, Kapusta A, Huvos PE, Bidwell SL, Zafar N, Tang H, Hadjithomas M, Krishnakumar V, Badger JH, Caler EV, Russ C, Zeng Q, Fan L, Levin JZ, Shea T, Young SK, Hegarty R, Daza R, Gujja S, Wortman JR, Birren BW, Nusbaum C, Thomas J, Carey CM, Pritham EJ, Feschotte C, Noto T, Mochizuki K, Papazyan R, Taverna SD, Dear PH, Cassidy-Hanley DM, Xiong J, Miao W, Orias E, Coyne RS (2016) Structure of the germline genome of Tetrahymena thermophila and relationship to the massivel

Sequences

>TTHERM_00464970(coding)
ATGGGCGATAAAGGTGATAAAGATGATGATAAAAAACAATAATAAAGTGAAATTAAGAAT
GGAGTTGAGAAACTCATCAAAATTGACAAAAAGCACGCAAATTTTGAAATCAATGACACT
TTATTTAATACCAAAGTAAAAGTCCGCAACATCAATTCCAGCACATCAAGCTCCATTTTG
GGCTAGAATCAACCTGAAAATACCTTGAGGTGTTTCTGGCGTCACATTAATAGATACTAC
TTTAGGAAATTAGATACAAATGAAATGGAAAGATTGTCCTATCTTGATCAATTATTCTCC
TTAAAATAAGATACTTCTCTTCAAAGGCAGAAGTATGCAAATCACATGGTTTACACTGCT
ATTTAAAATGTTATAGATAAAGAAAAATTTTTGGGTGATCAATAGTAATCTCCAGAAGTG
CAAAAAATTCTTTTCAAAATAGTTAAGGTTAATTGCAACATTTAGGCTTTGATTTATGAA
TGTCACTTTAAGGATAAAGCAAATTTGAAATTCTTAGATTAAATTATTAAAGAAAGAGAC
TAAATTACTCCTAAAAAGAGTACAAAAAAGAAAAGCATTAACGACTTGCAAAATGAATTA
TAAAAATTGAAAGCCATAGAAGAAAAGCTCTTAAAGCAAATAGAATAAAATTCAGATTAA
GATTCAAAGCATAGCAAAAAGAAAAATGGACATTAAAAAAAAGCTTAGAATTATTCTGAT
GAAGATAGCAACAATAGTGAAATAGATTAGGAAGATAATGATAATAGCAACAATCACGAT
AACATATCTACTGCTTCAAATGATGAAATAAGTTATTATGCAAAGCATAGTTCAAGAAAA
TTAGATTTTGAATAGGAAAGACTAGTCAGGCAATTAGAGGAAATCAATGCTATCAATAAA
TTAAACCTAAAAAAGCTAAATTAAAAAGTACAAGCTGAACTTAAAGAAGGAAAATAGATC
TTTTTTGAAAATCAAAATGACAATAGCAGTTTAGTAGTTCACGATAAGCACTCGCAAGGC
AAACAGCAGCAAACCAAGCAAAAGAAAAAAAGCAAGAAGAACAATGAGTATTCCTCAGAC
CACACAGATGCAGGAGTTGTAGATACTCTACCTAAATTTGGAGGATTTTAAAAAGAACTA
GGAAAGGACCCTCGTCCTAAGATGTCTGAAAAAGAAATTAGCGATTTGCACTTAAACTAT
TTATAGCAGTTGATATTTACTTTAGAAGAAAAATAAGTTGCTGACTCCATTTCTAAGATA
ACAAACTGTAAAAAAGAATCTAAAAAAGAGTTTCACTATGAAGTAATGTTTGAAGATGCT
CTAAACTCTCAACCTATCTACATAGATGAGAAAACTTTACTTAGATTCAACGAATACAGA
GAACATTCAATGTTGAGGAAATACAATTTACCTATTAAAACTCTCTTTTCCTCTACTTCT
CACAATTATGTTCAACTCACACAATATGTCACAAACAGAAATAAACCAAATCCTTATAAA
GATCAAGATATCTTAGATACTATTAAAAGAAATTCTAACTAGCATCATGACCAAACCCAC
CATAAAATCATTAATATGACTAGAAACTTTGACATATGCCATCATTGTAGATAAATTTTT
GAATTAGGGTATCTAGTTAAGTGCAATTATAGAAGCTCAGTCATGGGAATGCCATAGTCT
AGCCAATCAACTAACGATCAAATATTTATTTCATAAATTGTTGATTATGATAGCAATCAA
AGAAGACCATTCTTAAATAGAAAGAGAAACAATTACAATTCTTATATTAAGAAAAGCAAT
GGTGAGTTAGTTTGTAAGAGAAAATTTTGCATTCACTGCTTAAAGTAAAATTATGATTTC
AAGCATGATCAAAGCAAGACAGATTGGGTCTGTCCATTTTGCCAAAATTATTGCCACTGC
ATAAGATGTCTTAGAAATGAGTAAATAAACAAGCTTAAAGGTATATATTTACTATATGGT
GGCGATATATAATATTTGGAGTAGGAATCTATGCTTAATAAGTACTTGCGTCCTCTTTCA
GAAGAAGACAGAAAGAGAAAAGAAAGAGACGATATTTACAATAGGGCAACGAATAGCAGC
ATGATAGTATTTTAAGTTTAAAAGCAGACTTATGAAAAGGAAGTGGAAGAAGAAAAAACT
CTACAAACTAAGTTAGACGATCTTACCTACGTTAGATTAGATATGGAACGAGTAAGATTA
GTTATATCTTAAGTTTGCAGAAGAGAAAAACTTAAGCACTTTTAAATACTAGAAGAATAA
GAAACATTTAAAAAAAAGGAGCAAAAAATATAAATATAGCTTGAAAAAGCCTCAACTAAA
TTGAAGAAGCAGCAAGATAAAGAAATAGCCTAAAATTAAGAAAAAAAGAAAAAAGCTGAA
AAAGCTAAAAATGGAGCAACAAAAAAGAATGAAAAAAAGAAAGAAGAAACACCCAAAAAA
TCCGCAAAGGGCAAAAATAGAAACTCTAAAAACTCAGATTAAGAAACGGAAGACATTTAA
GAAGAATCAGAAAATTCTTCTTTGTAAGGTGATTCCTCTGAAATTGAATAAAGCAACTAA
TCAGACGTTGAACAGGACAGTGAAGAAGTCACAAGTGATGTAGAAAACAGCTCACAATAG
GAATCTAGTGGGCAAGAAGAAGAGGAAGAAGATGAAAATGAAAATGATCAAGAATAGTCA
AGTAAATCATAAATAATCGAAGATGAAGATGAAGTAGATCAAACAGATTCCTCAGTTATA
GAGTAAGAAGAATCTGAAAATGCAGTTACAGACGATTCTAATGAAGAAGAGTAACAATAA
AGCTAAGAAGAAGAAAGTGAAGATGAAGAAGAGGAGAATTAAGAAGAGAATGAATAGGAA
AGCTAAGAAGAGGAACAAGATAGCTAAGATTAAGAATCAGGAGATAAAGATGTAGAAGAA
GAAGAAAATGACGAAGATTAGACTGAAGATGCTGATGATGAAGAAAGTGAAAATGAAGAA
GTAGAATCAATTATTTAATCAGATGAAAGTACAATAGAAGAAAACCAAAGAAATAAATAA
AAAACTAGTAAATAAAAGCCTACGAAGAATGGAAAAGTAGCATAAACTAAAGCTTAATAA
AAATCTAAAAGTAAAGAAAAAGATTAAAAGAAAATTAAGTAGGTCTCAACAAAGAAAAAA
GAGCACATAAAAGCAGAAAAAGATAAGAAAAGCAATAAAAAGGATCCTAAATCAAAGAAA
TCTAAAAGAGGCTTAAGTTCATTATTTAGTAAAGAAATAAAAAATTTAATGAGAAACTAA
GATCCTTCTATTTTATAATTATCTTCAAAGAGGGAGAAGGCCTTAAGGTCAGCTACAAAT
CCTATAGAAACAAATTAACATAATCATAATAACATCACTAACGGAGTTAATAATAAAAAT
AAAAATAATAGCAATAATACTAAATAAAATATTTCTAAGTTCGAATAAACACCTAAAAAG
AAATAAAAAATTTGA


>TTHERM_00464970(protein)
MGDKGDKDDDKKQQQSEIKNGVEKLIKIDKKHANFEINDTLFNTKVKVRNINSSTSSSIL
GQNQPENTLRCFWRHINRYYFRKLDTNEMERLSYLDQLFSLKQDTSLQRQKYANHMVYTA
IQNVIDKEKFLGDQQQSPEVQKILFKIVKVNCNIQALIYECHFKDKANLKFLDQIIKERD
QITPKKSTKKKSINDLQNELQKLKAIEEKLLKQIEQNSDQDSKHSKKKNGHQKKAQNYSD
EDSNNSEIDQEDNDNSNNHDNISTASNDEISYYAKHSSRKLDFEQERLVRQLEEINAINK
LNLKKLNQKVQAELKEGKQIFFENQNDNSSLVVHDKHSQGKQQQTKQKKKSKKNNEYSSD
HTDAGVVDTLPKFGGFQKELGKDPRPKMSEKEISDLHLNYLQQLIFTLEEKQVADSISKI
TNCKKESKKEFHYEVMFEDALNSQPIYIDEKTLLRFNEYREHSMLRKYNLPIKTLFSSTS
HNYVQLTQYVTNRNKPNPYKDQDILDTIKRNSNQHHDQTHHKIINMTRNFDICHHCRQIF
ELGYLVKCNYRSSVMGMPQSSQSTNDQIFISQIVDYDSNQRRPFLNRKRNNYNSYIKKSN
GELVCKRKFCIHCLKQNYDFKHDQSKTDWVCPFCQNYCHCIRCLRNEQINKLKGIYLLYG
GDIQYLEQESMLNKYLRPLSEEDRKRKERDDIYNRATNSSMIVFQVQKQTYEKEVEEEKT
LQTKLDDLTYVRLDMERVRLVISQVCRREKLKHFQILEEQETFKKKEQKIQIQLEKASTK
LKKQQDKEIAQNQEKKKKAEKAKNGATKKNEKKKEETPKKSAKGKNRNSKNSDQETEDIQ
EESENSSLQGDSSEIEQSNQSDVEQDSEEVTSDVENSSQQESSGQEEEEEDENENDQEQS
SKSQIIEDEDEVDQTDSSVIEQEESENAVTDDSNEEEQQQSQEEESEDEEEENQEENEQE
SQEEEQDSQDQESGDKDVEEEENDEDQTEDADDEESENEEVESIIQSDESTIEENQRNKQ
KTSKQKPTKNGKVAQTKAQQKSKSKEKDQKKIKQVSTKKKEHIKAEKDKKSNKKDPKSKK
SKRGLSSLFSKEIKNLMRNQDPSILQLSSKREKALRSATNPIETNQHNHNNITNGVNNKN
KNNSNNTKQNISKFEQTPKKKQKI


>TTHERM_00464970(gene)
ATGGGCGATAAAGGTGATAAAGATGATGATAAAAAACAATAATAAAGTGAAATTAAGAAT
GGAGTTGAGAAACTCATCAAAATTGACAAAAAGCACGCAAATTTTGAAATCAATGACACT
TTATTTAAGTACTTCAAAACTCTACTTTTTTTTAAAGACTTTTCTTACAAATTTACAAAT
GTAATTGGGGGTATCGCACATAATTTATGATATTTCTTTTATGATAAAGTACCAAAGTAA
AAGTCCGCAACATCAATTCCAGCACATCAAGCTCCATTTTGGGCTAGAATCAACCTGAAA
ATACCTTGAGGTGTTTCTGGCGTCACATTAATAGATACTACTTTAGGAAATTAGATACAA
ATGAAATGGAAAGATTGTCCTATCTTGATCAATTATTCTCCTTAAAATAAGATAGTATGT
TAGCATTAAACTATTCCTTTGATTTCCTCCATTCCATTTATTGATTTCTTCATATCACAT
CCCACTGCAAGCCTTTCACTTTTTTCTATTTTCTTATATCCTTACTAACAAAAAGCAAGA
GAGGCTCTTTTATTGCCTAATAAAGAAAGAAGTTTTAATTAGTGTTCTTTTAATTAATAT
TATTATATTGATTAAATCTTCATTTTTGATATCAGTTTGTCAATTCTGCATTCATTTCAA
TAGAATATTGATTGCCCAACTGATTCTTTCTACATAAATTTTTTTTCTATTCATTTATGA
ATATAATATTTCCTTTTTGATTAATATTGGCAATAAGAAATATAAAAAATATTAATCCTT
CTGTCTCTCTATCTAATTAATTACTCTAAAAATTTTATTTTTCAAATTTTTAGAAAAATA
ATCAAAAAATTTCATTTAGTCATCAGGGCTTAATTAAATTTGATTTTGTTCCCAACACAA
AAAAATTCATGCAAATTGCAAATGTATTTACAAACATTTATTTAATCAAATAGCTTCTCT
TCAAAGGCAGAAGTATGCAAATCACATGGTTTACACTGCTATTTAAAATGTTATAGATAA
AGAAAAATTTTTGGGTGATCAATAGTAATCTCCAGAAGTGCAAAAAATTCTTTTCAAAAT
AGTTAAGGTTAATTGCAACATTTAGGCTTTGATTTATGAATGTCACTTTAAGGATAAAGC
AAATTTGAAATTCTTAGATTAAATTATTAAAGAAAGAGACTAAATTACTCCTAAAAAGAG
TACAAAAAAGAAAAGCATTAACGACTTGCAAAATGAATTATAAAAATTGAAAGCCATAGA
AGAAAAGCTCTTAAAGCAAATAGAATAAAATTCAGATTAAGATTCAAAGCATAGCAAAAA
GAAAAATGGACATTAAAAAAAAGCTTAGAATTATTCTGATGAAGATAGCAACAATAGTGA
AATAGATTAGGAAGATAATGATAATAGCAACAATCACGATAACATATCTACTGCTTCAAA
TGATGAAATAAGTTATTATGCAAAGCATAGTTCAAGAAAATTAGATTTTGAATAGGAAAG
ACTAGTCAGGCAATTAGAGGAAATCAATGCTATCAATAAATTAAACCTAAAAAAGTAAAT
ATTTCAACTTAATTTTTAAAACAAAATTTTAAATTCTGAACGATAAAAAAAATTGAGAAA
TTAAATCTATCTTGTTCTTATCAAAATTTGATTAAATTTCAAAATTAACCAAGAAAGTTT
CAACTAGATCTTATCAAAAATCATTATTTTTGTAAAATTAATATGAAATTTTTAGGAGAA
ATTGCATAACTCTTAAAAATTATTCAGTATCAATATAATTAAGGCATTCCTGATAAGATT
TGATTATTTCTGATGACTTATTAATCATTAAAGAAATCAAATTTTTCTAATTTTCTAAAA
ATTTTTATTTAATTTTTTTTTTTTAAATAGGCTAAATTAAAAAGTACAAGCTGAACTTAA
AGAAGGAAAATAGATCTTTTTTGAAAATCAAAATGACAATAGCAGTTTAGTAGTTCACGA
TAAGCACTCGCAAGGCAAACAGCAGCAAACCAAGCAAAAGAAAAAAAGCAAGAAGAACAA
TGAGTATTCCTCAGACCACACAGATGCAGGAGTTGTAGATACTCTACCTAAATTTGGAGG
ATTTTAAAAAGAACTAGGAAAGGACCCTCGTCCTAAGATGTCTGAAAAAGAAATTAGCGA
TTTGCACTTAAACTATTTATAGCAGTTGATATTTACTTTAGAAGAAAAATAAGTTGCTGA
CTCCATTTCTAAGATAACAAACTGTAAAAAAGAATCTAAAAAAGAGTTTCACTATGAAGT
AATGTTTGAAGATGCTCTAAACTCTCAACCTATCTACATAGATGAGAAAACTTTACTTAG
ATTCAACGAATACAGAGAACATTCAATGTTGAGGAAATACAATTTACCTATTAAAACTCT
CTTTTCCTCTACTTCTCACAATGTAAAATAATTAAAAAAGTAGAAATGTTTTAAAAAAAT
TAAATTTAAATAGTATGTTCAACTCACACAATATGTCACAAACAGAAATAAACCAAATCC
TTATAAAGATCAAGATATCTTAGATACTATTAAAAGAAATTCTAACTAGCATCATGACCA
AACCCACCATAAAATCATTAATATGACTAGAAACTTTGACATATGCCATCATTGTAGATA
AATTTTTGAATTAGGGTATCTAGTTAAGTGCAATTATAGAAGCTCAGTCATGGGAATGCC
ATAGTCTAGCCAATCAACTAACGATCAAATATTTATTTCATAAAGTAGCTTTTATAATAA
AATTTGACTCAAATAGTAAATAATTTCAATTAAAAAAATAGTTGTTGATTATGATAGCAA
TCAAAGAAGACCATTCTTAAATAGAAAGAGAAACAATTACAATTCTTATATTAAGAAAAG
CAGTAAAATATTTCAATTTTATTTAAAATCTAAGCTTTATTTTTTCATTTATTTTAAATA
AAGATGGTGAGTTAGTTTGTAAGAGAAAATTTTGCATTCACTGCTTAAAGTAAAATTATG
ATTTCAAGCATGATCAAAGCAAGACAGATTGGGTCTGTCCATTTTGCCAAGTAAATAAAT
TTAATGTTGAATCAAAAATAAAATTTTTCTTTTTAAAATAGAATTATTGCCACTGCATAA
GATGTCTTAGAAATGAGTAAATAAACAAGCTTAAAGGTATATATTTACTATATGGTGGCG
ATATATAATATTTGGAGTAGGAATCTATGCTTAATAAGTACTTGCGTCCTCTTTCAGAAG
AAGACAGAAAGAGAAAAGTATTTATATTATTTATCAGCATTAAAATTTAGGAATAAAAAT
TAAAATAAAATATTTTATTAGGAAAGAGACGATATTTACAATAGGGCAACGAATAGCAGC
ATGATAGTATTTTAAGTTTAAAAGCAGACTTATGAAAAGGAAGTGGAAGAAGAAAAAACT
CTACAAACTAAGTTAGACGATCTTACCTACGTTAGATTAGATATGGAACGAGTAAGATTA
GTTATATCTTAAGTTTGCAGAAGAGAAAAACTTAAGCACTTTTAAATACTAGAAGAATAA
GAAACATTTAAAAAAAAGGAGCAAAAAATATAAATATAGCTTGAAAAAGCCTCAACTAAA
TTGAAGAAGCAGCAAGATAAAGAAATAGCCTAAAATTAAGAAAAAAAGAAAAAAGCTGAA
AAAGGTATTTTTTATTTAAAATTATTTTTATTTTAAAATATTTCATAATCAAAATAGCTA
AAAATGGAGCAACAAAAAAGAATGAAAAAAAGAAAGAAGAAACACCCAAAAAATCCGCAA
AGGGCAAAAATAGAAACTCTAAAAACTCAGATTAAGAAACGGAAGACATTTAAGAAGAAT
CAGAAAATTCTTCTTTGTAAGGTGATTCCTCTGAAATTGAATAAAGCAACTAATCAGACG
TTGAACAGGACAGTGAAGAAGTCACAAGTGATGTAGAAAACAGCTCACAATAGGAATCTA
GTGGGCAAGAAGAAGAGGAAGAAGATGAAAATGAAAATGATCAAGAATAGTCAAGTAAAT
CATAAATAATCGAAGATGAAGATGAAGTAGATCAAACAGATTCCTCAGTTATAGAGTAAG
AAGAATCTGAAAATGCAGTTACAGACGATTCTAATGAAGAAGAGTAACAATAAAGCTAAG
AAGAAGAAAGTGAAGATGAAGAAGAGGAGAATTAAGAAGAGAATGAATAGGAAAGCTAAG
AAGAGGAACAAGATAGCTAAGATTAAGAATCAGGAGATAAAGATGTAGAAGAAGAAGAAA
ATGACGAAGATTAGACTGAAGATGCTGATGATGAAGAAAGTGAAAATGAAGAAGTAGAAT
CAATTATTTAATCAGATGAAAGTACAATAGAAGAAAACCAAAGAAATAAATAAAAAACTA
GTAAATAAAAGCCTACGAAGAATGGAAAAGTAGCATAAACTAAAGCTTAATAAAAATCTA
AAAGTAAAGAAAAAGATTAAAAGAAAATTAAGTAGGTCTCAACAAAGAAAAAAGAGCACA
TAAAAGCAGAAAAAGATAAGAAAAGCAATAAAAAGGTAAAAGAATATTTTATATTTATTA
AATAATTTATTGAATAAACAATATTAAAAAATGAATAGGATCCTAAATCAAAGAAATCTA
AAAGAGGCTTAAGTTCATTATTTAGTAAAGAAATAAAAAATTTAATGAGAAACTAAGATC
CTTCTATTTTATAATTATCTTCAAAGAGGGAGAAGGCCTTAAGGTCAGCTACAAATCCTA
TAGAAACAAATTAACATAATCATAATAACATCACTAACGGAGTTAATAATAAAAATAAAA
ATAATAGCAATAATACTAAATAAAATATTTCTAAGTTCGAATAAACACCTAAAAAGAAAT
AAAAAATTTGA