Identifiers and Description

Gene Model Identifier

TTHERM_00670640

Standard Name

AAP4 (Ada2-associated protein 4)

Aliases

PreTt01088 | 100.m00149 | 3731.m00059 | A2A4

Description

Member of the SAGA complex. PHD finger-containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00628 ) PHD-finger
  • ( PF02083 ) Urotensin II
  • ( PF04644 ) Motilin/ghrelin
  • ( PF06623 ) MHC_I C-terminus
  • ( PF08746 ) RING-like domain
  • ( PF00904 ) Involucrin repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF01667 ) Ribosomal protein S27
  • ( PF05535 ) Chromadorea ALT protein
  • ( PF08112 ) ATP synthase epsilon subunit
  • ( PF03508 ) Gap junction alpha-1 protein (Cx43)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF07740 ) Spider potassium channel inhibitory toxin
  • ( PF06991 ) Micro-fibrillar-associated protein 1 C-terminus

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00670640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16480.19.997093137033517e-262hypothetical protein (1262 aa)
SGDYPR031W0.00000000039982266684865623NTO1 Subunit of the NuA3 histo
ne acetyltransferase complex t
hat acetylates histone H3; con
tains PHD finger domain that i
nteracts with methylated histo
ne H3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00670640(coding)
ATGACTAGCTGCTACCTATGCAAAAATAGCAAGAGCAAGGAGTATACAGTGCGCGGCTTC
TTCGATAAGTCTAAACTCTAGGGACAGTATAAAGAAATTCCTGAGGAAGTCGATGTGCAT
ATTTCATGCTCACTTTTATTCAAAGATACCCGTCTTTTATAGGTAAATGGAAATTGGGAA
GTGAGAGGTTTAGAAGAAATTCTTAAACATCAAGTTTTCTCTTGTTAAAATTGTAAATAA
TCCTTTGATTGGAGATCTAGACCATTCATCATTAATTGTCATTATAACGAGTGTTTGGAG
ATGGGTTGTATCTAAAAGAAGAATAGATGTTCGAAACATCATTGTGCGTTTCCTTTAGAT
TTAAGATGCATATATGAAATGCAAGTATACGACATCTTTTTAGAAAGTGAAGAAATTCCA
TGCAAACTAAAGTTTTTATGTTTTAAGCACACGCAAAAAAGAGTAGGAGGAGGTTTTAAT
ATTCTCTAAATACAAGAACAAATAATGCAAAAAGTTTTTTAAAATTCTTAAAATCCATAG
CCATAAAGTTAGTTTAATTATCAGGTTAAATAGCCAATTCATCAGCCTAATCACCTTAAA
AGCGGTGAGCATTTGTTAGGCTAAAAGTACGATTAGAATGCATACAATTAAAATCAAGGA
TAACATTATAATTAGTAAAAATAGCAAGCAATTTAAGCATATGGGAATAGTAATGTGAAT
CAAAATAAGCAATAGTTCAATTAGGGAGAAATGTAGGGATATCAACCTTAAATTATATAG
CAATTTCCAGCTGCTCCTCAAACCTAAAACCCTTAATAGTATGTTAAGAATAGCTCAAAT
TAGCAAAAATTAGTTTAGACATCATAACCGATTAGCAATCCTTAATTTTCCTAGCATCAG
TAGTAGAAATTGAATTAGGAGTATTCAAATAATTAGCAATAGACATACTAATAGTACGAT
CTTTAAGGGCGCCCTGTTTAAATACCACCTCCTTCTCCTCGTATGACTTATTAAGGGGGT
AATTAAATTCCAAACAATAATTAAGCATATGATTAAAATTCAGTAATCCCACCTACTCAA
CAAACCACTGTGGGGGAAGTAGCACAGTACAATTCTTAGAACTCAGCAATACCTCCAGTT
TAGGATCCTTATTATTAGCATTCAGCAGGAGATTAGTAAAAAGTTACATCGGTAGTTCCT
TAAACTTAGCCAGTTGGTCAATATCCTAAAAATTAATAAGCTTATAGATAATGGGATTCT
AATTCTTAATAATATTAGTAATAATCAGCGACATACAACCCTTAAAATCCAAAGGTTCAG
TATTCTAGTTAGCCTAATAATCCAACAATTCAACCAATTTAATAGTAAAATCAAGGTATT
TACAAATAAACATCAAATGTAAATTAATAAGGGTTTAATGAAGATCCCATGCAACCTGTT
AACTAATTTAATTAACCAAAATAATTTTAAGGAGTCTAACCAATAAATTAAGATTATAAT
AATGGTTAGAATGCTTATAATTTGCATCAAAATCAATCAACTCAAAGAGGATTTACCAGC
AATTATCAAAGTGCTCAGTTTGCAGATGTTGGTGGATATAATAATATGTATAATAACGAC
AATTATGGTAATTAAAATAGCTACGAAAGATAGGATAATTTACAGTAAAATAATTAGCAA
GTTGGTACTGCTATTGATCCTGTTCAAACTCATGATAATACATACAGTTTCACAAGCAAT
AACCCACCTGCTAGATTAAATAAATAAACTACTTAGGAATATTAGGCGAATACATAAAAC
AGCAATACACCAGCATAAACATTTATTACGAATTCAACTGGAAGAAAAATTATGCATCCT
AATGTTGATACCAATCCAAATGGCATAAGTGTTGATATTACTGATCAAATAAAATTAAAA
CAACTCTAATAGCAGAGCAGAAAAGCCTAAGATTAATAGCAAGCAGTGCAAAGTTAATAA
GGTTATGCAGATAACTTGACTGATAATTCACAGTATCAAAAAACAAATTCTACTATATAA
TCTACCCCTGGATTAGCCCCACTTCAAGCTTAAGCTCCTCCTACTAACGGTGATTTTAGA
AACTTAAATCAATAATAAAATGCTTAGCCAGCAACTTCTAATAAATTCAATTAGAAGTAA
CAGCATTATTATTAAAATTAAAACTACCCAAACAGTAATTAATACTAGTAAGGAATGGCC
TAAAATTAGCAGGTTCCATATTAAAATAATTAGGGATTCAGTAATTAAAATTACTAAAAT
TAATAGTTTTAAAGTGTACCTAATTAGAATTTCAACAATTAAGGAATGAACCAATAGATT
CCTAATTAGAACGTTTAACAAAATTACGTAAATAATAATAAGAATAATTAATAAAATAAT
AACTTCTCTTATGGAGTTTAAGGAAATGGATCTTTTGCACCTATTTAAGAAAAGCCTCGA
GTTAACTTACCACCTCAAAGAGAAAGGTCTTAGTAGAGTGCACAGAGTTTTCCCTAAAAC
GATCAAGGAAATTTTAGTGTACCTATGTACAGAAGGCCTTCATAATAGCAATAATTTATT
CCTTAAAATTAGTAGCCTTCACTAATTCCTCATACTTTATCTAATTAACAATAGCTAATA
AATGATAACGCACTACCACAATTCAATTAGAGTGGATAGTAAAATGGAACTTTGCAAGCT
TAAGAAAACGATAATTAAATGAATATTGAAGAACCAAATATTCAACCTAAATTTATTGTT
TAGGAACCTGTGGCAGCAGTGGTTGCAGCACCTGAAACAAAAAAAAGAGGTGGAAAAAGA
GGTAAAAAAGATACTGAACCTTAAAACGAAGTAGCAAAGACAAATGACATTCCTTTAAAG
CATACTAAATCAGCCTAAAAGAAAATGGATAAAAAGAAAGGTAAAAAGTAAACTGCTATG
GAATAGGAAGAAGAGGAAGTAGTAGGTCAAAGTAATCAATAAACTCATACCTAATAAATG
AAAGATGAATCTTCAACTTTATAGCAGAATTAGAATTAAATATAAGAAAATAACTCTCAA
AATATTCAAAACAACAATAATCCCTAGTAGTAATTTGGATCAGAAAATAACATAGCTAAC
AAAATGGAAAGCTAAGAGAGTCTAGACTTCAAGAGCTAAACTTCTTTAGGAATCTAAGTT
TAAAGATAAAATCTGCAAATTTAGAAGGATTAAAAATTCAATTAAGCTTAGTATCAATAG
CATGTTTAAAATATTTAGTAAAATCCATCTAAGGCCAATCAATTTTAACCACCACCATAG
TAACTTACACATCCTTAGCCTTCATAAAATATTATTCATCCCCCACCTTTGAGTAAGCAA
TCTTCTATGCAATCACTACCTCCTGTTTTAGAAAATCCATAAAACCCTATTTTCGAACAT
CAATAATAAATTTAAAACAATTAGCTTCCTAGACATCCTTCTGGCAGTGTTTAACCTAGC
AATATTGCTGCTTAGTAAATGAACAGGCCATAAAACGTCTAACCTTTCAAGTAGTAAATA
AGACCTCATTAAGCTCTTAAAAAGAAATCAGGCCCCTTGATTAATGACTCTTACAAACCA
TTTTTTGTAGAATTAGTAGAAGTGCAACATTAAATTTAATAATATTAATACCATGAAAGA
ATGGTTTATCAATAGCAATAATAATAAATGATGATGAGACAGCATTAGATTGTTCAAGGC
TAAATTTTGTAGAATCAAAATTTTATGAATAAGTAAATTAAATTATCATAAAATCCAGGC
TCTTAAAACTATGGCTAAATGGCACCTCAACCTCAATTAAGCAGTTAAAATTCGGGGAAA
TTTGGTTAATAGAATGTACCCTTTTTAAATCAAAACCCTTCATAAGCTTAGTAACCTTAA
ATATAGGTTATCCCCCCTACACATCCTACACATCAATAGTAGCAGCCTCCATACCAAAAA
GTAAGCTAGAACGTCTAATAAAATCTAGTAAATGGTACTAATAACCAACAAATTGTTTAG
GGACAATTAAATTAAAATTAGAAAGTTAATTCCCAAAATCCAGCTCATCATCTTCATCAA
CAATAATATCCTTAAGGAAATCTTGTTTAACCGGCCAGTTAAGATTTTAAGAATGATATC
GGGAGTTATCATCCTTAAAATTAAAATCAAGGTGATATTTCTAAGGTTCCAACAGAATAA
AAAGACTATCGTTAATAATTCAGTAATTAAAATTTTGCTTTAGAAAATTTACATGAAGCT
CCACTTAAATAAAACTAACCTATATAATAAAACTCTTATCAACATCACCCATTTCCACAA
CCTCATTAAAAAAATAATGAACTCACAAATTATAATAATAATTATATATAAAATCCAGCA
CAAAATACCAACCTTCCTTATCCTAATTAGTTCTAATAAGGCGGAGGTGGATAATTATAA
TCCAATTTATATAGAGATTAAAAAAATTAAGATTTCAATAATAGTAATAAAAAATACTCT
AATAATTAGATAAACACAGGCACCGTAGTTACAAACAATCTAAATCATTCTTTCAACCCT
ACATAAAATAATTAATATTATTCTTAATAATCAAACTAATTTTCTTAGCAATAATACAAT
TTGGAAAAACAGAACAGTATCTAATCATTATAATAATAAAGAAGTATCTCATCTTAATAG
TAATCTTATAATTAATAAATTTCCTCATAATAAAATTTGGCTGTTCCTTCAAATAGTCAT
CCAAGTATCGACTAGTTCGATTCAAATAATATGATAAAATCCAATAATATAAGCAATCTA
TATCATAATTAAGGAGCTCCATTTAGGAATCCTTCAGGAGCAAATTTAGCGTTGAATGCT
ACTGTTCAACAGACTTCTTAAACTCAAATTTCAGCTTAATAAAATCATGGAGTATAAAAT
AGACATTCTTCAATATAATCTTCTGAATAATTGTTTTAAGGTCCTAGCAATACAAATCTA
AATTTATAAACTCTTACTAGCTTAAAAACGTTAAAACAAATTGATGAAAATGTAGAAAAT
ATTAGAGAAGAGGATCTTTTTCGTGAAGAAATGACTGAATCAGAAGAAAGCTTTTGGGAT
TACTGTTCACCTGAAAATTATTAGCATTTGTTACCTCAACATTAATCTAGTCAAAATAAC
TAGTAGTCGTCTTCAAGAAATAAATCTAAGCTAGGAGGTATATTTAATAATTAAGGTGCA
GCTCAAACTCAGTAAAAGTAGACTAAAAAGGGATAAGCAGCTAATCTAAGTAGCTAAAAC
TTACAAAAAGAAAAAGATCCTTATTTTGGTATTGATCCAGCTAAACTAATTGTTAAAAAT
TTTCCTTAAGGTGAAGATGAAGAATCTGTTTTTCAATGGTGGGATTAAATAGATGAAGTT
TATTTTCCAAATAAAATAAAAGAAGGTTTTTTTAATATGCTTGAAATTGAAAAATCTAAA
AATATTTCTGAAATGCTTTAAAGCCTCGACATTGTAGAAGTAGATGAAAACGGGTTAACA
AAACATATTCCTCCTATTAAATTAATCTAGTAGATATAAAGCGGAGTAACAGAGAATTCC
TCATTATATTATTTAATAGCTAAGGATTATTATGACGAAGAGCCTGTTCCATTTAAACAT
CCAAATTACTTTAGTGTTTTATTTTACAATTAGTTAAATAGCAACGACTATACAGGAAGT
GATAATTAAGATAATTCATCTCTTCTTTTAAAAAGACTCTAGTAGCCTAATAATGGAATA
TTAGCAGTGTTTAAATTAAAAATGTATGATAAAAAAAGACCTTTGACTTGTGAAGATAAA
AATATATTTGATAAATTAGTATCTAAAATAGAAATAGTACCTTAAAATAGTAAACCAAAA
ATTGAAGATATTTTTTAGAAATTAGATTATTCACTCTAAATATAAAATTCGACTGAAAAG
TAAGAACATAATAAAAATAAAAAATATAGTAAATAAAATAAAGATAAACAGGATTTAAGC
AAATATGAACCTGAATTATGTAAACAATTTATAGGAAATAATTAAATTATTCCAATACAA
TAATTAAAGCAAACCACTCCAGCTTAAAATTCAAATGATTTTTTATTTGATAAAAATAAA
ATAACAATCAAGCTAAAAAAATTGATAAGCCTCAATTCCTCTGCAGTTTACAGCTCATTT
TAAGCAACTAATTTTCTTAATAAATTTTTGAAAAACTAAAAATCAAAGTAAGAGAAATTA
AAAGATGAAAATTCTGAATAGGATGATTCAGATAGCGAGACAACCAAGGAATATCTTTAA
GCATAAAACAATAACTTATCTCCTATTGAATGCAACATATTTGCTTTGGAGTATGAATTG
ACTAAGCTTTAAACCCATCAGTAATTAAATCAACTTAAAGAAAATGTTTTTAAAAATTCT
AAGTAAGAAGGCAATTACTTGGAGTTAAGAGAATTATCAGTAAAAATAAATGATAATCTA
AAGTGGTTAACAATAAGAAAGAACCTGATATTGGGATTCAGTGACAGGCAAAGATATGAC
TCTGAAAATTATTTTAAATATGAGGCAGAAGAAAAAACAGGTATAAATCTTTCTAGAAGT
GAAGTTCTCTAAGAGAAAGAAATGTTAGAAAAAATGTCTTCAACAGAGAAAGAGAATTTG
AATTAATAGCAGCTACTTGCCCGTTAATTGTAATCATTATAAAGAGCAAAGAGGAAAAAT
TAGAAACAAGAAGAAGAAGAGGATGAAGAAGATGATGACTAAGGAGAAGAAAAGTCATAA
TTTAACAAAGATAAAAAATAAAGAAGCAAATAGAATGATGATAATGAAGACGAAGAAGAA
GATGATTATAATGATGAAGATGAAGATGGTGATGAAGAGGAAAGCAATCCCATTGAGCAT
GAAAATAAGAAAAAGGAAGAGTTAAAAAGAAACTCGAGAAGAAGTAATCGCATTAAGAGG
ATACTGGAAGATGAAAATGCAACCATTTTATCAAATGAGAATTCAATTGATGGTCTAGAA
ACAGTTTAAGAAAGTGATAGACTCGAGTCTCCTTCAGTTAATAGAAATAAAGATATTGAT
GATATTGAAAGCGATTAAAGAAAAGTAGACTAAAAAAATAAGATTTCTGCTTCTAGCAAT
AACAAAAAGAAGAAAAAATAAAAACAAAAGAATAAAAGTAAATTTTTGGAAATCGATTGT
AGCGTTTGCTTTCATCATGTTAATAATGAGAATAACACTGTTGTTTACTGCTCGTAATGC
AGTGGTAGTTTTCATAAGCACTGCTATGGCATAGATTTTATACCAGAAGAGAAATTTTTG
TGCAGAAAATGTGAAATTAAAAATTAATAAATTATGAAAAAGAAAAATACAAACAGTTGT
TAAAAATAACCTCTAAAAGAAGAGGTTTCCAAGCAATTTCATTGTAAACTATGTACTGAG
ACTCTCTTACCAGTTATATCTATCTTTGATGACTCTTATTTCTATCATCCTACTTGCCTC
TTCTTGTTTAATTATGCAATCTATAAAGATTAAAGATTGTAATTAAGAGACACTGTGACT
CATACATCAATATCTGATGATGTTAAGAAATAAAATCATATAGCTTGTGAGTTTTGTCAT
TCTAAAAAAGGTTTAAAGGTCAAATGTTGTCACTTTGGTAAACCACGCAAGTCTTTTGAA
AAAATTCACACACTTTAAAAATAAAAATTGTATAAAAAAAGAAACTGTTAATAGAGCTAA
GTTATTGATAGCAAGTAAGAATTTTAAGATTTAGAAAAAGAGAGTGAAAATGGTAACCTG
ATGTTAGCAGAAGTGAAAGAACTAACTGAGATTAGCTCAGAAAAGAAATAAAATGAAATA
AAAGAGGAAGATCTTGAAAAAAGCTGCTAAATAAAGGAAGAAAATGATATAATTAAATAA
GAAGAAAGCTAAGATGAAGAAGTAGAGTATTCTATTAGCGGAGAATATGAAGAGGATGAG
CTACTTGATGAAGAAGATGAAGATTATGAAGACTTAGGATGCAATTACTATATTCACCCC
CTTTGTGCCTTTCTTAACGGATTTGAGGTATGGCTCGATAGTAGGGAGGAAGATACTGAA
TGTGAAAAAACAATAGTTGATAGTGACTTTTAGAATTTGTAGCACCTAGGCTTGAAAATT
TTCTTCAAGTGCAAAGAACATGCAGATAGAAAGAATAGAAACTATGATGAATAAGTTTAT
TATAGAAGGTACCAAATAAATTATCGTAACATATGCTAATATACTACGTTTTAAGAGTAT
CAATAATCAATAACCAAATAGAGAACTTAGGAGGAAGAATAGTGGAATGAAATAGCTAAT
TTAGCAAAAGAATACATGGAAAATTATAAGTATTATACTAAAATAAAATTAAATAGGAAA
GAGATAGAAATAAGTTACTAACAATAAGAACAATTTTACCAATAAAATCCCAATCTCAAA
GAATAACTTCATCAACTTGAAATAGAAGAAATGGAAGAAGAAGCTGCAGAGTAGAAAGAA
TAAGAACATTTAATGCTAGTCAACTAACAAAATCTATAAAATCACCATAGCTTGTAGAAT
GTTGAGGACTTTTATGAAGATGAAAATATTGCCAATACAAACAACATGATTGAAGAAGGC
AATTCTTTGGATGATATTGATAATAGAAATGTATTAGAGGAAGAACTGGATGATGAATAT
GATGATGAGGAAGAGAACTCTTAATATAAGAGAAGATCGAGAAGGAATCTATCAAGAAAT
TAATAGCAACATAATTAATTAAGTGGTAAAAAGAGCAATTAGGATATTCAAGATGATTAC
TAAGACTAGATTGAAAATGAATATTCATAAGATGATACAAAGAAAGAAGTAAATAGAAGA
AGGGTTTTGAATTAGAAGAAAGGTTAGTAAAAAGCAAGTCTTATTTCTTAATCTTCGCTT
AGTGGAGGAACTGGAGAGACAAGCAAAAATAGACGTAGCAGTAGGAGATTAGTGAATAAT
AACTAGAAGGGAAAAAGCTAGTATTCCAGCTTCTTAAATGCAGATGAAGAAGAAGAAAAT
TAAGATTCCTCATATAACTAAGGTTACTCAAGCTTCGAAAATACACTAAACAAAATAAAT
TTAAAAGAATTTAGCAACAGTTAGCCAATTACTTAAGATAAACATACAAATCAACAACAA
TCATCCTTACAAGCACTAACTTAAATTATTTCTGAGAAAAAACAAAGCACAAATATTGAA
TAAGAAGAAGAGTTTAAAGGCATATCTAAGAAAGATTAAAAATAAAGCTAACCAAAGTAA
AAAGGAAAGAAAGGTTTAACAAGTAAATATAATGATGATGATGAAGAAGATCATGAGGAT
GAAGAATTTGGTATAGAAAATGAGTCATAGGATGAATTTGATGACGATGATTTTGATGAA
GAAGATGCTGATGACTAAAAGTATGCCTAAAAGAGAGGAATAGGAAAATTTGGAAGAAAT
AAAAGGACCAAGCCAAGAAGGAATTAATAGAAATACAATTAAAATGAACAGTCTTCCTCT
TCTTTAGAAAACATGTAACAAATTTCAAACTCAAGAGGTGCATCTCCTCCTAATAAATAA
AATGGAGCTTTAACAAATAATCAAGAAATTTAAAAGGTCCTTAGTACTGCTAGGAGTCTT
GCTAAAAATGGCAAAATAGGGAAAGGCACAAGCATTTTTGCGGCTCAGAATAAAAAGAAA
AAAGTATAAAAAAAAATAGGATCAAGGAATTCACTATTATCAGTAGAAAACGATGAAGAG
GAAGAATAGATAAATGAAATTGAAATAAATAAAGAAATTTAATAGTAAGATTAGTGTAAC
CCTGAAGTAAATACTGAGATAATTCAAGAAAATAATTGTTAGGTTAATCAAGAGGATGAA
TTAACACGTAACTAAGAATAGCAATTTATAGTAGAGTAATAGTAAAAATTACAAGTACAG
ACAGAAACTGATCATGTTTAAAATAAACCGTAAGTAGATGAAAAAGAAGAATAGCAAATT
ACAAATGAAAACACCCAAAATTCAAATTACCTTGATGTCAAAATTAATACATAACATTTA
AAAAGATCAAAAAGCCCATCAGATAAAAACACTTAAGAGTAGGTTCAAAAGCAAGATTTA
GAAGGCGACAATCTTAAATTGTTAGCCTAAAATTCAGACAATTAGCAATAAGCTAATCAA
ACCAAATACAATTTACGCTAACAAAAATCCAAAAATTACAAGCATAATTTAATTAAGGAG
GATAATGATTTTGTATATGCCTAAGTTGTGAATAATTCTTAATTTATAAAGTAGCAGCAA
AATGCTTTTTCTTAATTTGTTAACGAGTAAGGTTAAAATGAGGAAGATACAAGCAGTAAT
TTGCCTCAAAATAATTTGCAAAATAAAAAAAAATAAACTTCATAGACTAACATCCCACAA
GAAGGAACTCCAAAGCAAAAAAATAAAAAAAATTCAAAGTAGCCTCCAAGTTCTCAATAG
AATACAAATTAAACAAAAAAAGGATTAGACCCTAGTGAATAGGAATAGAATGATGAGTCT
TTTTCTAGTTGTGTTAATAACAACTAATAAGCAAATAATTAGAATGAATAAATAGAAATC
ACTAACCAATTTTCTCTGAATAGTCAACACTCTTACGAAGAAACTCACTCAAACGAATAA
AAACTAACAGTCAAAGGAAAAATAAATAAGAAAAAGCAAACTAAGGCTTAGACTTCTTCA
TAAAATTCAAGGTAAAATAGGAAAGCTAATAATCGAAACAAAGGATAAGCACATGAATAA
GAACACGTCTAAACAACAAAAGTTAACGATACTGCTACTCCACTCTTAGACCACCATAAT
AATCAAAAATATGTCTAAAGTTAAAAGAATTTTTAAATAAACAATCCTAATGAAAGCTAA
GAGCTGCTTGATTTTGATTAGTTTGAATAAAAAGACTAGATACTAAATCCTAATAACCTT
AAATACAACTGA


>TTHERM_00670640(protein)
MTSCYLCKNSKSKEYTVRGFFDKSKLQGQYKEIPEEVDVHISCSLLFKDTRLLQVNGNWE
VRGLEEILKHQVFSCQNCKQSFDWRSRPFIINCHYNECLEMGCIQKKNRCSKHHCAFPLD
LRCIYEMQVYDIFLESEEIPCKLKFLCFKHTQKRVGGGFNILQIQEQIMQKVFQNSQNPQ
PQSQFNYQVKQPIHQPNHLKSGEHLLGQKYDQNAYNQNQGQHYNQQKQQAIQAYGNSNVN
QNKQQFNQGEMQGYQPQIIQQFPAAPQTQNPQQYVKNSSNQQKLVQTSQPISNPQFSQHQ
QQKLNQEYSNNQQQTYQQYDLQGRPVQIPPPSPRMTYQGGNQIPNNNQAYDQNSVIPPTQ
QTTVGEVAQYNSQNSAIPPVQDPYYQHSAGDQQKVTSVVPQTQPVGQYPKNQQAYRQWDS
NSQQYQQQSATYNPQNPKVQYSSQPNNPTIQPIQQQNQGIYKQTSNVNQQGFNEDPMQPV
NQFNQPKQFQGVQPINQDYNNGQNAYNLHQNQSTQRGFTSNYQSAQFADVGGYNNMYNND
NYGNQNSYERQDNLQQNNQQVGTAIDPVQTHDNTYSFTSNNPPARLNKQTTQEYQANTQN
SNTPAQTFITNSTGRKIMHPNVDTNPNGISVDITDQIKLKQLQQQSRKAQDQQQAVQSQQ
GYADNLTDNSQYQKTNSTIQSTPGLAPLQAQAPPTNGDFRNLNQQQNAQPATSNKFNQKQ
QHYYQNQNYPNSNQYQQGMAQNQQVPYQNNQGFSNQNYQNQQFQSVPNQNFNNQGMNQQI
PNQNVQQNYVNNNKNNQQNNNFSYGVQGNGSFAPIQEKPRVNLPPQRERSQQSAQSFPQN
DQGNFSVPMYRRPSQQQQFIPQNQQPSLIPHTLSNQQQLINDNALPQFNQSGQQNGTLQA
QENDNQMNIEEPNIQPKFIVQEPVAAVVAAPETKKRGGKRGKKDTEPQNEVAKTNDIPLK
HTKSAQKKMDKKKGKKQTAMEQEEEEVVGQSNQQTHTQQMKDESSTLQQNQNQIQENNSQ
NIQNNNNPQQQFGSENNIANKMESQESLDFKSQTSLGIQVQRQNLQIQKDQKFNQAQYQQ
HVQNIQQNPSKANQFQPPPQQLTHPQPSQNIIHPPPLSKQSSMQSLPPVLENPQNPIFEH
QQQIQNNQLPRHPSGSVQPSNIAAQQMNRPQNVQPFKQQIRPHQALKKKSGPLINDSYKP
FFVELVEVQHQIQQYQYHERMVYQQQQQQMMMRQHQIVQGQILQNQNFMNKQIKLSQNPG
SQNYGQMAPQPQLSSQNSGKFGQQNVPFLNQNPSQAQQPQIQVIPPTHPTHQQQQPPYQK
VSQNVQQNLVNGTNNQQIVQGQLNQNQKVNSQNPAHHLHQQQYPQGNLVQPASQDFKNDI
GSYHPQNQNQGDISKVPTEQKDYRQQFSNQNFALENLHEAPLKQNQPIQQNSYQHHPFPQ
PHQKNNELTNYNNNYIQNPAQNTNLPYPNQFQQGGGGQLQSNLYRDQKNQDFNNSNKKYS
NNQINTGTVVTNNLNHSFNPTQNNQYYSQQSNQFSQQQYNLEKQNSIQSLQQQRSISSQQ
QSYNQQISSQQNLAVPSNSHPSIDQFDSNNMIKSNNISNLYHNQGAPFRNPSGANLALNA
TVQQTSQTQISAQQNHGVQNRHSSIQSSEQLFQGPSNTNLNLQTLTSLKTLKQIDENVEN
IREEDLFREEMTESEESFWDYCSPENYQHLLPQHQSSQNNQQSSSRNKSKLGGIFNNQGA
AQTQQKQTKKGQAANLSSQNLQKEKDPYFGIDPAKLIVKNFPQGEDEESVFQWWDQIDEV
YFPNKIKEGFFNMLEIEKSKNISEMLQSLDIVEVDENGLTKHIPPIKLIQQIQSGVTENS
SLYYLIAKDYYDEEPVPFKHPNYFSVLFYNQLNSNDYTGSDNQDNSSLLLKRLQQPNNGI
LAVFKLKMYDKKRPLTCEDKNIFDKLVSKIEIVPQNSKPKIEDIFQKLDYSLQIQNSTEK
QEHNKNKKYSKQNKDKQDLSKYEPELCKQFIGNNQIIPIQQLKQTTPAQNSNDFLFDKNK
ITIKLKKLISLNSSAVYSSFQATNFLNKFLKNQKSKQEKLKDENSEQDDSDSETTKEYLQ
AQNNNLSPIECNIFALEYELTKLQTHQQLNQLKENVFKNSKQEGNYLELRELSVKINDNL
KWLTIRKNLILGFSDRQRYDSENYFKYEAEEKTGINLSRSEVLQEKEMLEKMSSTEKENL
NQQQLLARQLQSLQRAKRKNQKQEEEEDEEDDDQGEEKSQFNKDKKQRSKQNDDNEDEEE
DDYNDEDEDGDEEESNPIEHENKKKEELKRNSRRSNRIKRILEDENATILSNENSIDGLE
TVQESDRLESPSVNRNKDIDDIESDQRKVDQKNKISASSNNKKKKKQKQKNKSKFLEIDC
SVCFHHVNNENNTVVYCSQCSGSFHKHCYGIDFIPEEKFLCRKCEIKNQQIMKKKNTNSC
QKQPLKEEVSKQFHCKLCTETLLPVISIFDDSYFYHPTCLFLFNYAIYKDQRLQLRDTVT
HTSISDDVKKQNHIACEFCHSKKGLKVKCCHFGKPRKSFEKIHTLQKQKLYKKRNCQQSQ
VIDSKQEFQDLEKESENGNLMLAEVKELTEISSEKKQNEIKEEDLEKSCQIKEENDIIKQ
EESQDEEVEYSISGEYEEDELLDEEDEDYEDLGCNYYIHPLCAFLNGFEVWLDSREEDTE
CEKTIVDSDFQNLQHLGLKIFFKCKEHADRKNRNYDEQVYYRRYQINYRNICQYTTFQEY
QQSITKQRTQEEEQWNEIANLAKEYMENYKYYTKIKLNRKEIEISYQQQEQFYQQNPNLK
EQLHQLEIEEMEEEAAEQKEQEHLMLVNQQNLQNHHSLQNVEDFYEDENIANTNNMIEEG
NSLDDIDNRNVLEEELDDEYDDEEENSQYKRRSRRNLSRNQQQHNQLSGKKSNQDIQDDY
QDQIENEYSQDDTKKEVNRRRVLNQKKGQQKASLISQSSLSGGTGETSKNRRSSRRLVNN
NQKGKSQYSSFLNADEEEENQDSSYNQGYSSFENTLNKINLKEFSNSQPITQDKHTNQQQ
SSLQALTQIISEKKQSTNIEQEEEFKGISKKDQKQSQPKQKGKKGLTSKYNDDDEEDHED
EEFGIENESQDEFDDDDFDEEDADDQKYAQKRGIGKFGRNKRTKPRRNQQKYNQNEQSSS
SLENMQQISNSRGASPPNKQNGALTNNQEIQKVLSTARSLAKNGKIGKGTSIFAAQNKKK
KVQKKIGSRNSLLSVENDEEEEQINEIEINKEIQQQDQCNPEVNTEIIQENNCQVNQEDE
LTRNQEQQFIVEQQQKLQVQTETDHVQNKPQVDEKEEQQITNENTQNSNYLDVKINTQHL
KRSKSPSDKNTQEQVQKQDLEGDNLKLLAQNSDNQQQANQTKYNLRQQKSKNYKHNLIKE
DNDFVYAQVVNNSQFIKQQQNAFSQFVNEQGQNEEDTSSNLPQNNLQNKKKQTSQTNIPQ
EGTPKQKNKKNSKQPPSSQQNTNQTKKGLDPSEQEQNDESFSSCVNNNQQANNQNEQIEI
TNQFSLNSQHSYEETHSNEQKLTVKGKINKKKQTKAQTSSQNSRQNRKANNRNKGQAHEQ
EHVQTTKVNDTATPLLDHHNNQKYVQSQKNFQINNPNESQELLDFDQFEQKDQILNPNNL
KYN


>TTHERM_00670640(gene)
ATGACTAGCTGCTACCTATGCAAAAATAGCAAGAGCAAGGAGTATACAGTGCGCGGCTTC
TTCGATAAGTCTAAACTCTAGGGACAGTATAAAGAAATTCCGTAAATTCATTTTTACTTT
TTCTTGATTATTTTTTCTTTTTCTTTTCTGTTTTAAGCTTTAGCTTTAATTGATTCTTCT
TTTTTTCTTGTTTTGATGCTAGCAGCATTGCTAAAGAACGAGAAAGCGAAAAAAAAGAGG
AAGGTTATAATAGCATAAATTTTAAATAGGAAGAATTGTAATAATATATTAGAGGTTAAA
TATTTTAGTTTTTGTATAAACCATTTAATTGCTGTTATTATGCATGCGTGTTTGTTTTTT
AAAGTTAAATCGGTAAACAGAAAAGAAAAAAATTTCACTTTATAAAAATTATTTTATACA
ATTTTCAATTATTATTTGTTAACATTTATTTTTTTTTCAACAAAATTTTTGTAGTGAGGA
AGTCGATGTGCATATTTCATGCTCACTTTTATTCAAAGATACCCGTCTTTTATAGGTAAA
TGGAAATTGGGAAGTGAGAGGTTTAGAAGAAATTCTTAAACATCAAGTTTTCTCTTGTTA
AAATTGTAAATAATCCTTTGATTGGAGATCTAGACCATTCATCATTAATTGTCATTATAA
CGAGTGTTTGGAGATGGGTTGTATCTAAAAGAAGAATAGATGTTCGAAACATCATTGTGC
GTTTCCTTTAGATTTAAGATGCATATATGAAATGCAAGTATACGACATCTTTTTAGAAAG
TGAAGAAATTCCATGCAAACTAAAGTTTTTATGTTTTAAGCACACGCAAAAAAGAGTAGG
AGGAGGTTTTAATATTCTCTAAATACAAGAACAAATAATGCAAAAAGTTTTTTAAAATTC
TTAAAATCCATAGCCATAAAGTTAGTTTAATTATCAGGTTAAATAGCCAATTCATCAGCC
TAATCACCTTAAAAGCGGTGAGCATTTGTTAGGCTAAAAGTACGATTAGAATGCATACAA
TTAAAATCAAGGATAACATTATAATTAGTAAAAATAGCAAGCAATTTAAGCATATGGGAA
TAGTAATGTGAATCAAAATAAGCAATAGTTCAATTAGGGAGAAATGTAGGGATATCAACC
TTAAATTATATAGCAATTTCCAGCTGCTCCTCAAACCTAAAACCCTTAATAGTATGTTAA
GAATAGCTCAAATTAGCAAAAATTAGTTTAGACATCATAACCGATTAGCAATCCTTAAGT
ATTTTAAAAATAAAAAAAATCAGTTTAAGTAAACGATTTTTAAAATGAATAGTTTTCCTA
GCATCAGTAGTAGAAATTGAATTAGGAGTATTCAAATAATTAGCAATAGACATACTAATA
GTACGATCTTTAAGGGCGCCCTGTTTAAATACCACCTCCTTCTCCTCGTATGACTTATTA
AGGGGGTAATTAAATTCCAAACAATAATTAAGCATATGATTAAAATTCAGTAATCCCACC
TACTCAACAAACCACTGTGGGGGAAGTAGCACAGTACAATTCTTAGAACTCAGCAATACC
TCCAGTTTAGGATCCTTATTATTAGCATTCAGCAGGAGATTAGTAAAAAGTTACATCGGT
AGTTCCTTAAACTTAGCCAGTTGGTCAATATCCTAAAAATTAATAAGCTTATAGATAATG
GGATTCTAATTCTTAATAATATTAGTAATAATCAGCGACATACAACCCTTAAAATCCAAA
GGTTCAGTATTCTAGTTAGCCTAATAATCCAACAATTCAACCAATTTAATAGTAAAATCA
AGGTATTTACAAATAAACATCAAATGTAAATTAATAAGGGTTTAATGAAGATCCCATGCA
ACCTGTTAACTAATTTAATTAACCAAAATAATTTTAAGGAGTCTAACCAATAAATTAAGA
TTATAATAATGGTTAGAATGCTTATAATTTGCATCAAAATCAATCAACTCAAAGAGGATT
TACCAGCAATTATCAAAGTGCTCAGTTTGCAGATGTTGGTGGATATAATAATATGTATAA
TAACGACAATTATGGTAATTAAAATAGCTACGAAAGATAGGATAATTTACAGTAAAATAA
TTAGCAAGTTGGTACTGCTATTGATCCTGTTCAAACTCATGATAATACATACAGTTTCAC
AAGCAATAACCCACCTGCTAGATTAAATAAATAAACTACTTAGGAATATTAGGCGAATAC
ATAAAACAGCAATACACCAGCATAAACATTTATTACGAATTCAACTGGAAGAAAAATTAT
GCATCCTAATGTTGATACCAATCCAAATGGCATAAGTGTTGATATTACTGATCAAATAAA
ATTAAAACAACTCTAATAGCAGAGCAGAAAAGCCTAAGATTAATAGCAAGCAGTGCAAAG
TTAATAAGGTTATGCAGATAACTTGACTGATAATTCACAGTATCAAAAAACAAAGTATGA
TTTAACTTTTAGCATTTTCATTAACTTTGCTTGTTATTAGAATTAGATAAATATTTTTTA
TTTATTCTTTATTGAATTTATTTATTTTAAAAAATAAAAGTTCTACTATATAATCTACCC
CTGGATTAGCCCCACTTCAAGCTTAAGCTCCTCCTACTAACGGTGATTTTAGAAACTTAA
ATCAATAATAAAATGCTTAGCCAGCAACTTCTAATAAATTCAATTAGAAGTAACAGCATT
ATTATTAAAATTAAAACTACCCAAACAGTAATTAATACTAGTAAGGAATGGCCTAAAATT
AGCAGGTTCCATATTAAAATAATTAGGGATTCAGTAATTAAAATTACTAAAATTAATAGT
TTTAAAGTGTACCTAATTAGAATTTCAACAATTAAGGAATGAACCAATAGATTCCTAATT
AGAACGTTTAACAAAATTACGTAAATAATAATAAGAATAATTAATAAAATAATAACTTCT
CTTATGGAGTTTAAGGAAATGGATCTTTTGCACCTATTTAAGAAAAGCCTCGAGTTAACT
TACCACCTCAAAGAGAAAGGTCTTAGTAGAGTGCACAGAGTTTTCCCTAAAACGATCAAG
GAAATTTTAGTGTACCTATGTACAGAAGGCCTTCATAATAGCAATAATTTATTCCTTAAA
ATTAGTAGCCTTCACTAATTCCTCATACTTTATCTAATTAACAATAGCTAATAAATGATA
ACGCACTACCACAATTCAATTAGAGTGGATAGTAAAATGGAACTTTGCAAGCTTAAGAAA
ACGATAATTAAATGAATATTGAAGAACCAAATATTCAACCTAAATTTATTGTTTAGGAAC
CTGTGGCAGCAGTGGTTGCAGCACCTGAAACAAAAAAAAGAGGTGGAAAAAGAGGTAAAA
AAGATACTGAACCTTAAAACGAAGTAGCAAAGACAAATGACATTCCTTTAAAGCATACTA
AATCAGCCTAAAAGAAAATGGATAAAAAGAAAGGTAAAAAGTAAACTGCTATGGAATAGG
AAGAAGAGGAAGTAGTAGGTCAAAGTAATCAATAAACTCATACCTAATAAATGAAAGATG
AATCTTCAACTTTATAGCAGAATTAGAATTAAATATAAGAAAATAACTCTCAAAATATTC
AAAACAACAATAATCCCTAGTAGTAATTTGGATCAGAAAATAACATAGCTAACAAAATGG
AAAGCTAAGAGAGTCTAGACTTCAAGAGCTAAACTTCTTTAGGAATCTAAGTTTAAAGAT
AAAATCTGCAAATTTAGAAGGATTAAAAATTCAATTAAGCTTAGTATCAATAGCATGTTT
AAAATATTTAGTAAAATCCATCTAAGGCCAATCAATTTTAACCACCACCATAGTAACTTA
CACATCCTTAGCCTTCATAAAATATTATTCATCCCCCACCTTTGAGTAAGCAATCTTCTA
TGCAATCACTACCTCCTGTTTTAGAAAATCCATAAAACCCTATTTTCGAACATCAATAAT
AAATTTAAAACAATTAGCTTCCTAGACATCCTTCTGGCAGTGTTTAACCTAGCAATATTG
CTGCTTAGTAAATGAACAGGCCATAAAACGTCTAACCTTTCAAGTAGTAAATAAGACCTC
ATTAAGCTCTTAAAAAGAAATCAGGCCCCTTGATTAATGACTCTTACAAACCATTTTTTG
TAGAATTAGTAGAAGTGCAACATTAAATTTAATAATATTAATACCATGAAAGAATGGTTT
ATCAATAGCAATAATAATAAATGATGATGAGACAGCATTAGATTGTTCAAGGCTAAATTT
TGTAGAATCAAAATTTTATGAATAAGTAAATTAAATTATCATAAAATCCAGGCTCTTAAA
ACTATGGCTAAATGGCACCTCAACCTCAATTAAGCAGTTAAAATTCGGGGAAATTTGGTT
AATAGAATGTACCCTTTTTAAATCAAAACCCTTCATAAGCTTAGTAACCTTAAATATAGG
TTATCCCCCCTACACATCCTACACATCAATAGTAGCAGCCTCCATACCAAAAAGTAAGCT
AGAACGTCTAATAAAATCTAGTAAATGGTACTAATAACCAACAAATTGTTTAGGGACAAT
TAAATTAAAATTAGAAAGTTAATTCCCAAAATCCAGCTCATCATCTTCATCAACAATAAT
ATCCTTAAGGAAATCTTGTTTAACCGGCCAGTTAAGATTTTAAGAATGATATCGGGAGTT
ATCATCCTTAAAATTAAAATCAAGGTAATAAAGAAATAAATTCTTGAAATTCGATTAATT
TATTTATTAAATTAAATGGAAAATCCTTCATTAACTTAATTAATTAATTACTCTCATTTA
TTAAGCTTCTAAAATTATTCTTATTACAATTCAAAATTTACATTCTCCACCTACTTTCTC
AAATAAGCTCTCATTCCATTTAAAATCTCTCCCTCCCTCCCTCCATCCTACATCTTACTT
ACTTAAATAATTTAATAAAATAAAACTTTTGCTAGTAAACAATAAAAAAATAAATAATTG
TTAGCTATTTATTCATTGCAAACACTTAAAAGTCACTTAATAGGGATTAAACCAAGCTAC
CCAAAGCAGACGATGCTATATTTAAATTAAAAAATTGAATCAAATAGAAAAAATGAAATA
AATACTGAAAGGAGCAATCAATTATTTAAAAGCAATTTATTTCAAACAAGTGTGTAAGTT
TAATGAGAAAGCGAAATTTTGGAGACTAAGGATTCATAATATATTAATCTATTTAAAAAA
TTTTTTTTCAATAATTTAAATCACTCCACCAACCAATAAAAAATAAATAAAGAAATATAA
ATAAAAGAGAAAAATTCAAACATAGAAAGATAAAATTTTATAATTTTGTGATAATTTTTA
ATTCACTAAACAAAACCTAATAAAAAAAAGGTAATAAAATAATTACAAAAATAAACAATA
GAATATGAAGGTAGAGAGAAATAACTATTAATTAATTAAATAAAGCACAATCTCTCAAAT
AAAAACTAATTAATATGTTCATAGCAATAATCCACCAAAACACAAAAAATAAAAAAAACC
TTTTATTATTTATATACCTCACAAATAGATAAATAAATTATAAACTCAATTAATTAATTA
AATAAATAAATAAATAAATCATCTGGAGTGAACAAGTATAAGATAGAAAAGAGATTACTA
TAATTAATTCAATAATCTATATTTTGAAAATAAATTTGTTGTAAATTTCAGATATGTTTG
CTTATTTCGTTGACTCTTCCTTAAATTTTATATTGAAGACAATGATGAAAACACATTCAT
TTTTTCCCAAATTTATAAATACTTCATATCTATTTTTTTTAACATTTATTATTTAGTCAT
CTCTTTTCTTTTATACAATAATTATCTGTTATTTTAATCACTTGTTTTAATTCCTTTTTA
TTTTTGATTTTTATTTTAACCAATTTGAAATATTTTTGTTTTATCACGATAAAGATTTTG
TTTATTTTTCGTAGGAAAACATGGGAGTATTTTAAAATTAAAAAAACCAAAATACATAAA
CACTCTATATATAAATTTTCATATTATTAGTAAGAAATTAATTAATTATATTTAATAATT
TTTCTTTATTTTATTATATAGGTGATATTTCTAAGGTTCCAACAGAATAAAAAGACTATC
GTTAATAATTCAGTAATTAAAATTTTGCTTTAGAAAATTTACATGAAGCTCCACTTAAAT
AAAACTAACCTATATAATAAAACTCTTATCAACATCACCCATTTCCACAACCTCATTAAA
AAAATAATGAACTCACAAATTATAATAATAATTATATATAAAATCCAGCACAAAATACCA
ACCTTCCTTATCCTAATTAGTTCTAATAAGGCGGAGGTGGATAATTATAATCCAATTTAT
ATAGAGATTAAAAAAATTAAGATTTCAATAATAGTAATAAAAAATACTCTAATAATTAGA
TAAACACAGGCACCGTAGTTACAAACAATCTAAATCATTCTTTCAACCCTACATAAAATA
ATTAATATTATTCTTAATAATCAAACTAATTTTCTTAGCAATAATACAATTTGGAAAAAC
AGAACAGTATCTAATCATTATAATAATAAAGAAGTATCTCATCTTAATAGTAATCTTATA
ATTAATAAATTTCCTCATAATAAAATTTGGCTGTTCCTTCAAATAGTCATCCAAGTATCG
ACTAGTTCGATTCAAATAATATGATAAAATCCAATAATATAAGCAATCTATATCATAATT
AAGGAGCTCCATTTAGGAATCCTTCAGGAGCAAATTTAGCGTTGAATGCTACTGTTCAAC
AGACTTCTTAAACTCAAATTTCAGCTTAATAAAATCATGGAGTATAAAATAGACATTCTT
CAATATAATCTTCTGAATAATTGTTTTAAGGTCCTAGCAATACAAATCTAAATTTATAAA
CTCTTACTAGCTTAAAAACGTTAAAACAAATTGATGAAAATGTAGAAAATATTAGAGAAG
AGGATCTTTTTCGTGAAGAAATGACTGAATCAGAAGAAAGCTTTTGGGATTACTGTTCAC
CTGAAAATTATTAGCATTTGTTACCTCAACATTAATCTAGTCAAAATAACTAGTAGTCGT
CTTCAAGAAATAAATCTAAGCTAGGAGGTATATTTAATAATTAAGGTGCAGCTCAAACTC
AGTAAAAGTAGACTAAAAAGGGATAAGCAGCTAATCTAAGTAGCTAAAACTTACAAAAAG
AAAAAGATCCTTATTTTGGTATTGATCCAGCTAAACTAATTGTTAAAAATTTTCCTTAAG
GTGAAGATGAAGAATCTGTTTTTCAATGGTGGGATTAAATAGATGAAGTTTATTTTCCAA
ATAAAATAAAAGAAGGTTTTTTTAATATGCTTGAAATTGAAAAATCTAAAAATATTTCTG
AAATGCTTTAAAGCCTCGACATTGTAGAAGTAGATGAAAACGGGTTAACAAAACATATTC
CTCCTATTAAATTAATCTAGTAGATATAAAGCGGAGTAACAGAGAATTCCTCATTATATT
ATTTAATAGCTAAGGATTATTATGACGAAGAGCCTGTTCCATTTAAACATCCAAATTACT
TTAGTGTTTTATTTTACAATTAGTTAAATAGCAACGACTATACAGGAAGTGATAATTAAG
ATAATTCATCTCTTCTTTTAAAAAGACTCTAGTAGCCTAATAATGGAATATTAGCAGTGT
TTAAATTAAAAATGTATGATAAAAAAAGACCTTTGACTTGTGAAGATAAAAATATATTTG
ATAAATTAGTATCTAAAATAGAAATAGTACCTTAAAATAGTAAACCAAAAATTGAAGATA
TTTTTTAGAAATTAGATTATTCACTCTAAATATAAAATTCGACTGAAAAGTAAGAACATA
ATAAAAATAAAAAATATAGTAAATAAAATAAAGATAAACAGGATTTAAGCAAATATGAAC
CTGAATTATGTAAACAATTTATAGGAAATAATTAAATTATTCCAATACAATAATTAAAGC
AAACCACTCCAGCTTAAAATTCAAATGATTTTTTATTTGATAAAAATAAAATAACAATCA
AGCTAAAAAAATTGATAAGCCTCAATTCCTCTGCAGTTTACAGCTCATTTTAAGCAACTA
ATTTTCTTAATAAATTTTTGAAAAACTAAAAATCAAAGTAAGAGAAATTAAAAGATGAAA
ATTCTGAATAGGATGATTCAGATAGCGAGACAACCAAGGAATATCTTTAAGCATAAAACA
ATAACTTATCTCCTATTGAATGCAACATATTTGCTTTGGAGTATGAATTGACTAAGCTTT
AAACCCATCAGTAATTAAATCAACTTAAAGAAAATGTTTTTAAAAATTCTAAGTAAGAAG
GCAATTACTTGGAGTTAAGAGAATTATCAGTAAAAATAAATGATAATCTAAAGTGGTTAA
CAATAAGAAAGAACCTGATATTGGGATTCAGTGACAGGCAAAGATATGACTCTGAAAATT
ATTTTAAATATGAGGCAGAAGAAAAAACAGGTATAAATCTTTCTAGAAGTGAAGTTCTCT
AAGAGAAAGAAATGTTAGAAAAAATGTCTTCAACAGAGAAAGAGAATTTGAATTAATAGC
AGCTACTTGCCCGTTAATTGTAATCATTATAAAGAGCAAAGAGGAAAAATTAGAAACAAG
AAGAAGAAGAGGATGAAGAAGATGATGACTAAGGAGAAGAAAAGTCATAATTTAACAAAG
ATAAAAAATAAAGAAGCAAATAGAATGATGATAATGAAGACGAAGAAGAAGATGATTATA
ATGATGAAGATGAAGATGGTGATGAAGAGGAAAGCAATCCCATTGAGCATGAAAATAAGA
AAAAGGAAGAGTTAAAAAGAAACTCGAGAAGAAGTAATCGCATTAAGAGGATACTGGAAG
ATGAAAATGCAACCATTTTATCAAATGAGAATTCAATTGATGGTCTAGAAACAGTTTAAG
AAAGTGATAGACTCGAGTCTCCTTCAGTTAATAGAAATAAAGATATTGATGATATTGAAA
GCGATTAAAGAAAAGTAGACTAAAAAAATAAGATTTCTGCTTCTAGCAATAACAAAAAGA
AGAAAAAATAAAAACAAAAGAATAAAAGTAAATTTTTGGAAATCGATTGTAGCGTTTGCT
TTCATCATGTTAATAATGAGAATAACACTGTTGTTTACTGCTCGTAATGCAGTGGTAGTT
TTCATAAGCACTGCTATGGCATAGATTTTATACCAGAAGAGAAATTTTTGTGCAGAAAAT
GTGAAATTAAAAATTAATAAATTATGAAAAAGAAAAATACAAACAGTTGTTAAAAATAAC
CTCTAAAAGAAGAGGTTTCCAAGCAATTTCATTGTAAACTATGTACTGAGACTCTCTTAC
CAGTTATATCTATCTTTGATGACTCTTATTTCTATCATCCTACTTGCCTCTTCTTGTTTA
ATTATGCAATCTATAAAGATTAAAGATTGTAATTAAGAGACACTGTGACTCATACATCAA
TATCTGATGATGTTAAGAAATAAAATCATATAGCTTGTGAGTTTTGTCATTCTAAAAAAG
GTTTAAAGGTCAAATGTTGTCACTTTGGTAAACCACGCAAGTCTTTTGAAAAAATTCACA
CACTTTAAAAATAAAAATTGTATAAAAAAAGAAACTGTTAATAGAGCTAAGTTATTGATA
GCAAGTAAGAATTTTAAGATTTAGAAAAAGAGAGTGAAAATGGTAACCTGATGTTAGCAG
AAGTGAAAGAACTAACTGAGATTAGCTCAGAAAAGAAATAAAATGAAATAAAAGAGGAAG
ATCTTGAAAAAAGCTGCTAAATAAAGGAAGAAAATGATATAATTAAATAAGAAGAAAGCT
AAGATGAAGAAGTAGAGTATTCTATTAGCGGAGAATATGAAGAGGATGAGCTACTTGATG
AAGAAGATGAAGATTATGAAGACTTAGGATGCAATTACTATATTCACCCCCTTTGTGCCT
TTCTTAACGGATTTGAGGTATGGCTCGATAGTAGGGAGGAAGATACTGAATGTGAAAAAA
CAATAGTTGATAGTGACTTTTAGAATTTGTAGCACCTAGGCTTGAAAATTTTCTTCAAGT
GCAAAGAACATGCAGATAGAAAGAATAGAAACTATGATGAATAAGTTTATTATAGAAGGT
ACCAAATAAATTATCGTAACATATGCTAATATACTACGTTTTAAGAGTATCAATAATCAA
TAACCAAATAGAGAACTTAGGAGGAAGAATAGTGGAATGAAATAGCTAATTTAGCAAAAG
AATACATGGAAAATTATAAGTATTATACTAAAATAAAATTAAATAGGAAAGAGATAGAAA
TAAGTTACTAACAATAAGAACAATTTTACCAATAAAATCCCAATCTCAAAGAATAACTTC
ATCAACTTGAAATAGAAGAAATGGAAGAAGAAGCTGCAGAGTAGAAAGAATAAGAACATT
TAATGCTAGTCAACTAACAAAATCTATAAAATCACCATAGCTTGTAGAATGTTGAGGACT
TTTATGAAGATGAAAATATTGCCAATACAAACAACATGATTGAAGAAGGCAATTCTTTGG
ATGATATTGATAATAGAAATGTATTAGAGGAAGAACTGGATGATGAATATGATGATGAGG
AAGAGAACTCTTAATATAAGAGAAGATCGAGAAGGAATCTATCAAGAAATTAATAGCAAC
ATAATTAATTAAGTGGTAAAAAGAGCAATTAGGATATTCAAGATGATTACTAAGACTAGA
TTGAAAATGAATATTCATAAGATGATACAAAGAAAGAAGTAAATAGAAGAAGGGTTTTGA
ATTAGAAGAAAGGTTAGTAAAAAGCAAGTCTTATTTCTTAATCTTCGCTTAGTGGAGGAA
CTGGAGAGACAAGCAAAAATAGACGTAGCAGTAGGAGATTAGTGAATAATAACTAGAAGG
GAAAAAGCTAGTATTCCAGCTTCTTAAATGCAGATGAAGAAGAAGAAAATTAAGATTCCT
CATATAACTAAGGTTACTCAAGCTTCGAAAATACACTAAACAAAATAAATTTAAAAGAAT
TTAGCAACAGTTAGCCAATTACTTAAGATAAACATACAAATCAACAACAATCATCCTTAC
AAGCACTAACTTAAATTATTTCTGAGAAAAAACAAAGCACAAATATTGAATAAGAAGAAG
AGTTTAAAGGCATATCTAAGAAAGATTAAAAATAAAGCTAACCAAAGTAAAAAGGAAAGA
AAGGTTTAACAAGTAAATATAATGATGATGATGAAGAAGATCATGAGGATGAAGAATTTG
GTATAGAAAATGAGTCATAGGATGAATTTGATGACGATGATTTTGATGAAGAAGATGCTG
ATGACTAAAAGTATGCCTAAAAGAGAGGAATAGGAAAATTTGGAAGAAATAAAAGGACCA
AGCCAAGAAGGAATTAATAGAAATACAATTAAAATGAACAGTCTTCCTCTTCTTTAGAAA
ACATGTAACAAATTTCAAACTCAAGAGGTGCATCTCCTCCTAATAAATAAAATGGAGCTT
TAACAAATAATCAAGAAATTTAAAAGGTCCTTAGTACTGCTAGGAGTCTTGCTAAAAATG
GCAAAATAGGGAAAGGCACAAGCATTTTTGCGGCTCAGAATAAAAAGAAAAAAGTATAAA
AAAAAATAGGATCAAGGAATTCACTATTATCAGTAGAAAACGATGAAGAGGAAGAATAGA
TAAATGAAATTGAAATAAATAAAGAAATTTAATAGTAAGATTAGTGTAACCCTGAAGTAA
ATACTGAGATAATTCAAGAAAATAATTGTTAGGTTAATCAAGAGGATGAATTAACACGTA
ACTAAGAATAGCAATTTATAGTAGAGTAATAGTAAAAATTACAAGTACAGACAGAAACTG
ATCATGTTTAAAATAAACCGTAAGTAGATGAAAAAGAAGAATAGCAAATTACAAATGAAA
ACACCCAAAATTCAAATTACCTTGATGTCAAAATTAATACATAACATTTAAAAAGATCAA
AAAGCCCATCAGATAAAAACACTTAAGAGTAGGTTCAAAAGCAAGATTTAGAAGGCGACA
ATCTTAAATTGTTAGCCTAAAATTCAGACAATTAGCAATAAGCTAATCAAACCAAATACA
ATTTACGCTAACAAAAATCCAAAAATTACAAGCATAATTTAATTAAGGAGGATAATGATT
TTGTATATGCCTAAGTTGTGAATAATTCTTAATTTATAAAGTAGCAGCAAAATGCTTTTT
CTTAATTTGTTAACGAGTAAGGTTAAAATGAGGAAGATACAAGCAGTAATTTGCCTCAAA
ATAATTTGCAAAATAAAAAAAAATAAACTTCATAGACTAACATCCCACAAGAAGGAACTC
CAAAGCAAAAAAATAAAAAAAATTCAAAGTAGCCTCCAAGTTCTCAATAGAATACAAATT
AAACAAAAAAAGGATTAGACCCTAGTGAATAGGAATAGAATGATGAGTCTTTTTCTAGTT
GTGTTAATAACAACTAATAAGCAAATAATTAGAATGAATAAATAGAAATCACTAACCAAT
TTTCTCTGAATAGTCAACACTCTTACGAAGAAACTCACTCAAACGAATAAAAACTAACAG
TCAAAGGAAAAATAAATAAGAAAAAGCAAACTAAGGCTTAGACTTCTTCATAAAATTCAA
GGTAAAATAGGAAAGCTAATAATCGAAACAAAGGATAAGCACATGAATAAGAACACGTCT
AAACAACAAAAGTTAACGATACTGCTACTCCACTCTTAGACCACCATAATAATCAAAAAT
ATGTCTAAAGTTAAAAGAATTTTTAAATAAACAATCCTAATGAAAGCTAAGAGCTGCTTG
ATTTTGATTAGTTTGAATAAAAAGACTAGATACTAAATCCTAATAACCTTAAATACAACT
GA