Identifiers and Description

Gene Model Identifier

TTHERM_00444700

Standard Name

AAP1 (Ada2-associated protein 1)

Aliases

PreTt03838 | 51.m00204 | 3704.m00060 | A2A1

Description

Member of the SAGA complex. PHD finger-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00444700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10884.19.997093137033517e-262PHD-finger family protein (186
7 aa)
OxytrichaContig14165.0.g661.9994920269952867e-34PHD-zinc-finger like domain
WormBaseWBGene000030343.998609120989657e-17locus:lin-49 Protein lin-49
status:Confirmed UniProt:Q
20318 protein_id:CCD67656.1
SGDYPR031W8.997498379799854e-17NTO1 Subunit of the NuA3 histo
ne acetyltransferase complex t
hat acetylates histone H3; con
tains PHD finger domain that i
nteracts with methylated histo
ne H3
Stentor CoeruleusSteCoe_84350.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00444700(coding)
ATGAGTGATATAAGTAGTGTAAGCGGAGAAACGGATAGCTAGTTAGACAACATGTTTCCC
TAAGATGAAGAAGAAGATGTAGAAGGTTAAGATAAGCCAATTAACTCGATAGCAAACAAT
TTTAGAAATAATTAAATGCAAATTGAAAATTCAAAAGAAGAAAGCGACTTAGACTTTGAT
AGCGAAGATGATGATAATTATGCAGATGATGCAGATAGCGATATTTTTGATGATGAATTA
AAAGATTCAAAATTAAAATAATTGTCCAACGGAAACAAAGCTGAATACAAACAATCAAAT
AATAGAAAAGTTGATTACGATAGTGCATTAAATGATTCAAATAGCGTAAGCTAATCCGGT
ATATAACTTAAAACTTAGAATAGCTGCAAAAAGAAACCTAAAAATTTAAGCAAGACCAAG
GAATATAATAGCTATGGAAACAAATAAAATAAATAGAATAAGCACCATTCAAATCAGGAC
GATTAAGAAGAATATGATAGTGAAGAGCATTAACAAGATGAGGATGATGCCTTAGAGGAA
GAAGAAGAGTCTTAAGGAGAGGATAATGAGAAGGAGAACTAAGATGACTTTTACAATGAA
TCCTTCTTATAGTCAAGTGATAATCTTGACAATCGAGAAAACCTTGATAAATCATCAGAT
GATTTAGATTTATCATTCTCTAATCAAACTAGTAGACAAGCCACAAGCTAACAGCAGTCA
ATTGCAAATGTTGCAATAGGCAAAAGAAAGAATTCATTGAAATTAAACTAATTTACTATG
CTTGGATCTCCTAGGGCTAGTAGAAAAAACTCAGATATACTTTAAAAAGAGAATTCTATG
ATATAAGTATCGAAACCTTCTGACAAACTTAAAAAATAATACCGTAAATACCAAGAACTA
GCATCATTGATACCAACACTTAGGTATTTTGAATGGTATGAGACAACTGCATTTTAAAAT
AAGCTTTTGCCAATTAAATTTTTGACGGCAGCTTCGTTTTGGTTCATGGTCTGTGCAGAA
TACTTTCCAAGAAAAATGGCTTACTAAAAAGAAGAAGATATTATAAAGGATTTAAGAAAT
AGGATAGATAAAATGTATATGGAAATTATAAACCGTACTGGAAAATAATAAAATTAAAAA
TCAAATAGCAGCAATAATTTAAACCAATTTTAAAGTGCTAGTAATTTACAAAACGATGAT
AAATCAGAAGACAGTATTATACAAGAAAATGAAGATCTTAAAACATAAAATGAAAGCGGA
GGAGCAAACAATCACTAGGAAGAAAATACAAATAAAGAATTTGAAATTAATTAAAATGAA
GATTCAAAACCTTAGTATCAAGAAAATAAAGAGAGCAATTCAAGAGAAAAATAGAATAAA
TTGAATTTAGATATAAGTGTCGAAGGAGAAAATTGTAGTAATCATTAAGAATATGATCAG
AATAATGATTTTTAAAAAGAATAAATTTAAAAAGATTAGCAAGTTAATACAAAAGTTTTA
GATAAAAATAATATAGAAAAATAATATTAAACAGAATATATTGATGAATAGCTGCAATAC
ACTTAAAGTAATTCATCTAGTTTTAAAAAGGCTCAAACATAATATTATAGTAAACTGTCA
CAACTCATTTCTGATAAAGAACCTTCTGCATCCTCGAAAGATAGAAGTAAAGATAGCAAC
ACTAAATTAGGAGATGACTAAGAGAGCTCTCAGATAACGTGCTCTGAGTAAAACGGTATT
TTATATAAGATCAATGAAGATAGCACTTAATAGATAAATATAGAAAAAGAAGCTAAAAAT
GAAACTCTTAAAGAAGCGTTTGAAGAAGCAGTAACAGAGAAAATCTAAGAATAGCTTAAC
AATTTAGAATAGTTTATAAATGATTTTTAACAAAATAATTTTATCTCTTAATCTTAAATT
TTAGAGGAATCACACAAAGAAAATCAAATTTCTCACAGTAATAATTAGAATTAATAAAAG
GCAGAGATAAAGAACTAAGATGAAAATGAAAACCTCAAGAACGAACAAAAAAATAGTTTG
AAAAATCAATTAAATTCGTTAGACAAATAAATAAATTTTATAATAGATTAAAATTAAACC
AAAGAAATAAACCAAGTCAAATTAAATTACATTAATAAACACGCATACACTTTTGAAGAT
GAAGTTTATATTATACAAAATAGATTATTTCTCTTGGAGACATTAAATTACTTCTAAATA
ATGGAGGAGTCTTCAAATGAAGAAAAATTAATTTAGTTAAAAAATATAGAGTTAGAAAAA
ATAATTAACCTCCTTATCATACGCTACTAATAGCAGTATGAGCAAAACAATAAAGAGTTC
GAAAATTTAAAACTTAGAATTAAAGAAGACTTTGAGCAAGAGAGAAGAATTAATGATGTA
TAAAGCTTAGATTTTAATGATATATTAATAGATTTAAACACAATGAACCCTATAGAAAAA
GAATATATAAAATTCTTAGAGTCAAAATAATAATTGGATTACAGCTAATCAATCTAAATA
ATGCAACAACAGTAAAATATTTTAGGAGATTTACCAGATTAGGCTATTGTAGGGTAGCAA
TCCTTAAAATCTTAGGGTTCAACAAAGTAAGTTTTAATTAAACATAGTGAAGAAACTAGA
TGCCAAGTTTGTAATGAGTGTGATTATGCTGATAATGATCTGATCGTTTTTTGTTCAAGG
TGCAACATGTCAGTGCATTAAAAGTGCTATGGTATTGCTTCTCTACCATAAGAAGATTGG
ATATGCGACGCATGCATATCCTTTGGACCTAATGCAAAGTATTTAAGATGTGCACTTTGT
ACTAAAAGAGGAGGAGCTCTTAAAAGGTCAAAAATGCCTGTAAAAACAAACTTTTTTGAG
CATCTTAATACAGATTATCACTCCTATTTAAAAAATCTCCCTGAAGAATTCAGCGATTAA
CCTGAAGTTTACGACACATCACTTTGGGAAAATGATAAGAAGAGAAGTACTAACAAATCT
CCTCAAAATGATGAAAATTAAGAAGAAACAGAACTCTATTTTGATTTTTAGTATTAAAAT
AAGGTATATCCACCTGAGGAAATTCAAAAATATGAGCCAAAATCAAAGAATATTTGGATC
CACCTCACTTGTGCTTTGTGGATATAAGAATGCTATTTTGAAGAGAGATCCTCACTAAAT
ATGATTAGAGGAATAGAAAATATAGATAAGAAGAGATTCTTGTTAACTTGTTTGATTTGT
AAGCAGAAAAAAAGTGGCTGCTGCATTTAGTGTGCAAAAGGTAAATGCTCTGCTTCTTTC
CATCCGGAATGTGCTAGGAGAGCAGGACTTTCGCTTGAAGTACGACATCTTGAAAAAGTC
ACTCACTTGGTGTTTTGTTAAAGACATACTCCTTTAAAATTGAGAAGAATTCTTGAACAG
AAAGAGAAAAAATATAAAGATGAGATTCAAAAATTCTGCAGATCTATTGAAAAATACAAT
GAAACTTATTTCAATGAATATAAAGCCAAAGAAAAATAGAAGGCATTTAAGCCTTCTAAA
ACCCTGCTTAAAAAAGCACTTAAAGATTAAGAAAGAGAAGAAAAAGAATTTATGAAACAA
TTTAGCCTTTATCTTCTGGAAACACCATAAAATAATTTTGTAATAAACCTCTCTAAAGAA
TATGATGACTTTGAAGAATCTATAATAGCCTATCATGTTGTAGATATTAACAGACCAAAA
TAATAGCATTTAAGAACTTAGATTTCTAAAAATGACGATATTTGGAAAACAATAGAATTT
AATGAATATCCTCCAATCCATTTGTTTAAATTATATAAAAAGCTCATAAAATCAAAAAAA
GTAGAATTTAAAAATATATTTAATAGCCTAAAGAGAATCAAAGATAAAGAGCAAGAAGAA
CTTTTTATTAAGCAATAAAAATAAATGAAAAAAGAATAGTAAATGCTGAAAAAGGAGATG
CTTCGTTAAGAAAAAGAAAAGAAGAAAATGCTTTAAAAGCAGAAACAATTAGAAGGTTTG
AATCCTCGTAAAATTTTGCACACAGAGAATGATAACATAGAATCTAGCTAAATAAACTAA
ACAAATGAGTTATCCTTTCTTGATGACGAAACATCAAAAATGTAGCTATCATAATCGATT
TAATAAATCCAAAGAGCAATTTAACCAAAAAGAAAATATAATAAGTAAAAAAAGAATAAT
ATTTTAGAAAACAATGCAAGCAGCAATGAAAATGGGTATTCTTACATTCAAAATGAAAGC
AATGTTAATTAATCTTAAAATGGAGACTTAAGATTTAATCAGCAATCTCATCTAAATGCT
GATACAAGTAACTATAACTAAGAAATAGAAAATTCAAATGCTTTTCCTGATATTGTAAGT
GCCTCAAGTGATTTTCCATTAAAATCTAAATCAAAAGATAAGAAATCCTAAAAAATTAAA
GAAAAGCAAAATGAAAAACATATAAAAAATTATAAAAATATTGATTCACAGCAAAGCTTG
GATAAATAAAAGAATCTCAAAAAGAAATTAAATAAGCATAGATCGAAAGGTGAATATCAA
TTAAATTCCTAAGGTGAAGAATAATTTGTCTTAAATAAAAGTGCTAAATCAGTGTAAGGT
GAAGACGATGATGAAAAGCTTTACTGTTATTGCCAAAAGCCCTATAATGAAGGTGAATTC
ATGATATAATGCTAAAATTGTGAAGAGTGGTTTCATTTTGAATGTATTGGGTATATTGGA
ACTGATACAGAGGCTGAAGATATTGATTTTTTTTGTAATGAATGTGATGTAGATGGTAAA
TTATTTTAGAGTAAAGAAGAATATGAGCGCTTCTTTGATCCTTAGCAAGCTCTCTACTCT
ACCTACAAGCAGCTAAAAAATAAAATCACAACTCCATCTTTCAGGTAAAAGCTTATCTTG
GAACGTAAAGACTTAGCTTCTGCAAATAGTATTCATAGTAGTACTAACTTAAAAAGCGAA
AAGAAGAAAGATAAAAAAACTACTAGTGGTTTATAAGAAAATGAATCTAATAGCTTAAGC
AAGAGCAAGGCATCAAACACAGCAAATAGCTCATAAGATTTGGCAAATAAAAAATTACAA
AGTAATGAATAGGCTCTTTTATCGTAGCTTATTTAAATAAGTGAAAACTAAATGAAAAAG
CAATAAGAAAAATCTAATGGTGTAATGGAGGTTGAGCTTGTCAACCAATAAATTCCCAAA
AATAACCATAATGATTAAGATAAAGAACTTTATGAAGAATTATAAGAGAGTTTTAGTGAT
ATTATGAATTCTAGTTAAGAAGAAAATAATAGAATAGAAAAAACTATTTCAATAGAAAAA
GAAGATAATGAGGAGGAAAGTTTAGAATTATTATATGAAGAATTCACTGATTCATATATT
AAATAAAATAACATTATATTAGAAGAAGTTAGTACGATTATTAAATTAAGAAAATTAGAA
GATGGAAGCATAATTCTGGTAGAAGATTAGAATATATAACCTTAAGAATGA


>TTHERM_00444700(protein)
MSDISSVSGETDSQLDNMFPQDEEEDVEGQDKPINSIANNFRNNQMQIENSKEESDLDFD
SEDDDNYADDADSDIFDDELKDSKLKQLSNGNKAEYKQSNNRKVDYDSALNDSNSVSQSG
IQLKTQNSCKKKPKNLSKTKEYNSYGNKQNKQNKHHSNQDDQEEYDSEEHQQDEDDALEE
EEESQGEDNEKENQDDFYNESFLQSSDNLDNRENLDKSSDDLDLSFSNQTSRQATSQQQS
IANVAIGKRKNSLKLNQFTMLGSPRASRKNSDILQKENSMIQVSKPSDKLKKQYRKYQEL
ASLIPTLRYFEWYETTAFQNKLLPIKFLTAASFWFMVCAEYFPRKMAYQKEEDIIKDLRN
RIDKMYMEIINRTGKQQNQKSNSSNNLNQFQSASNLQNDDKSEDSIIQENEDLKTQNESG
GANNHQEENTNKEFEINQNEDSKPQYQENKESNSREKQNKLNLDISVEGENCSNHQEYDQ
NNDFQKEQIQKDQQVNTKVLDKNNIEKQYQTEYIDEQLQYTQSNSSSFKKAQTQYYSKLS
QLISDKEPSASSKDRSKDSNTKLGDDQESSQITCSEQNGILYKINEDSTQQINIEKEAKN
ETLKEAFEEAVTEKIQEQLNNLEQFINDFQQNNFISQSQILEESHKENQISHSNNQNQQK
AEIKNQDENENLKNEQKNSLKNQLNSLDKQINFIIDQNQTKEINQVKLNYINKHAYTFED
EVYIIQNRLFLLETLNYFQIMEESSNEEKLIQLKNIELEKIINLLIIRYQQQYEQNNKEF
ENLKLRIKEDFEQERRINDVQSLDFNDILIDLNTMNPIEKEYIKFLESKQQLDYSQSIQI
MQQQQNILGDLPDQAIVGQQSLKSQGSTKQVLIKHSEETRCQVCNECDYADNDLIVFCSR
CNMSVHQKCYGIASLPQEDWICDACISFGPNAKYLRCALCTKRGGALKRSKMPVKTNFFE
HLNTDYHSYLKNLPEEFSDQPEVYDTSLWENDKKRSTNKSPQNDENQEETELYFDFQYQN
KVYPPEEIQKYEPKSKNIWIHLTCALWIQECYFEERSSLNMIRGIENIDKKRFLLTCLIC
KQKKSGCCIQCAKGKCSASFHPECARRAGLSLEVRHLEKVTHLVFCQRHTPLKLRRILEQ
KEKKYKDEIQKFCRSIEKYNETYFNEYKAKEKQKAFKPSKTLLKKALKDQEREEKEFMKQ
FSLYLLETPQNNFVINLSKEYDDFEESIIAYHVVDINRPKQQHLRTQISKNDDIWKTIEF
NEYPPIHLFKLYKKLIKSKKVEFKNIFNSLKRIKDKEQEELFIKQQKQMKKEQQMLKKEM
LRQEKEKKKMLQKQKQLEGLNPRKILHTENDNIESSQINQTNELSFLDDETSKMQLSQSI
QQIQRAIQPKRKYNKQKKNNILENNASSNENGYSYIQNESNVNQSQNGDLRFNQQSHLNA
DTSNYNQEIENSNAFPDIVSASSDFPLKSKSKDKKSQKIKEKQNEKHIKNYKNIDSQQSL
DKQKNLKKKLNKHRSKGEYQLNSQGEEQFVLNKSAKSVQGEDDDEKLYCYCQKPYNEGEF
MIQCQNCEEWFHFECIGYIGTDTEAEDIDFFCNECDVDGKLFQSKEEYERFFDPQQALYS
TYKQLKNKITTPSFRQKLILERKDLASANSIHSSTNLKSEKKKDKKTTSGLQENESNSLS
KSKASNTANSSQDLANKKLQSNEQALLSQLIQISENQMKKQQEKSNGVMEVELVNQQIPK
NNHNDQDKELYEELQESFSDIMNSSQEENNRIEKTISIEKEDNEEESLELLYEEFTDSYI
KQNNIILEEVSTIIKLRKLEDGSIILVEDQNIQPQE


>TTHERM_00444700(gene)
ATGAGTGATATAAGTAGTGTAAGCGGAGAAACGGATAGCTAGTTAGACAACATGTTTCCC
TAAGATGAAGAAGAAGATGTAGAAGGTTAAGATAAGCCAATTAACTCGATAGCAAACAAT
TTTAGAAATAATTAAATGCAAATTGAAAATTCAAAAGTAAATTTTTAAATTAATGGATTT
TTCTTTGAGCAAATAAACCAAAATGCATAACACTTTAGATTAATCATCTATTTTTATTAT
AGGAAGAAAGCGACTTAGACTTTGATAGCGAAGATGATGATAATTATGCAGATGATGCAG
ATAGCGATATTTTTGATGATGAATTAAAAGATTCAAAATTAAAATAATTGTCCAACGGAA
ACAAAGCTGAATACAAACAATCAAATAATAGAAAAGTTGATTACGATAGTGCATTAAATG
ATTCAAATAGCGTAAGCTAATCCGGTATATAACTTAAAGTAATATTTTTCTTTATCCCCC
CTTTTCAATGTTTTATTTTTCTTTTAATTCACATAGTCCCCTAATATTTGTTTTTAAATT
GTTATAAATGTTCAAGCATAGTCATATTATTTTAGGAAAAAAGGTATAAAATGTAAATTG
CAATGATAAAATAAACTCTTAAAGTTAATTTTAAACTAAAATTCTCCATTAAAAAGTGCT
TTGAACTTTAAACTTTATCTCTAATTTAAAACAATTTTGTTGATTATTCTTTATCAAACA
TATCTTCTTTTAAAAAAAACTAGACTTAGAATAGCTGCAAAAAGAAACCTAAAAATTTAA
GCAAGACCAAGGAATATAATAGCTATGGAAACAAATAAAATAAATAGAATAAGCACCATT
CAAATCAGGACGATTAAGAAGAATATGATAGTGAAGAGCATTAACAAGATGAGGATGATG
CCTTAGAGGAAGAAGAAGAGTCTTAAGGAGAGGATAATGAGAAGGAGAACTAAGATGACT
TTTACAATGAATCCTTCTTATAGTCAAGTGATAATCTTGACAATCGAGAAAACCTTGATA
AATCATCAGATGATTTAGATTTATCATTCTCTAATCAAACTAGTAGACAAGCCACAAGCT
AACAGCAGTCAATTGCAAATGTTGCAATAGGCAAAAGAAAGAATTCATTGAAATTAAACT
AATTTACTATGCTTGGATCTCCTAGGGCTAGTAGAAAAAACTCAGATATACTTTAAAAAG
AGAATTCTATGATATAAGTATCGAAACCTTCTGACAAACTTAAAAAATAATACCGTAAAT
ACCAAGAACTAGCATCATTGATACCAACACTTAGGTATTTTGAATGGTATGAGACAACTG
CATTTTAAAATAAGCTTTTGCCAAGTATAAAAAACATTGTTTCTGATTACTTAATTTGTC
CATAAATTATTTTTGATTAACTTTTTACAGGAGTTTTAATAAATTAATAGCTATTTGATT
AATTTTACTCTTATTAGAAAATTAGAAAATTAATTTTAAATTTAAGAAGTAAAAAACAAA
CAAATCAAAAAATAAACAACTACTTCTATATTTAACAACTAATCATATCATTTAAAATTT
AAAGTTAAATTTTTGACGGCAGCTTCGTTTTGGTTCATGGTCTGTGCAGAATACTTTCCA
AGAAAAATGGCTTACTAAAAAGAAGAAGATATTATAAAGGATTTAAGAAATAGGATAGAT
AAAATGTATATGGAAATTATAAACCGTACTGGAAAATAATAAAATTAAAAATCAAATAGC
AGCAATAATTTAAACCAATTTTAAAGTGCTAGTAATTTACAAAACGATGATAAATCAGAA
GACAGTATTATACAAGAAAATGAAGATCTTAAAACATAAAATGAAAGCGGAGGAGCAAAC
AATCACTAGGAAGAAAATACAAATAAAGAATTTGAAATTAATTAAAATGAAGATTCAAAA
CCTTAGTATCAAGAAAATAAAGAGAGCAATTCAAGAGAAAAATAGAATAAATTGAATTTA
GATATAAGTGTCGAAGGAGAAAATTGTAGTAATCATTAAGAATATGATCAGAATAATGAT
TTTTAAAAAGAATAAATTTAAAAAGATTAGCAAGTTAATACAAAAGTTTTAGATAAAAAT
AATATAGAAAAATAATATTAAACAGAATATATTGATGAATAGCTGCAATACACTTAAAGT
AATTCATCTAGTTTTAAAAAGGCTCAAACATAATATTATAGTAAACTGTCACAACTCATT
TCTGATAAAGAACCTTCTGCATCCTCGAAAGATAGAAGTAAAGATAGCAACACTAAATTA
GGAGATGACTAAGAGAGCTCTCAGATAACGTGCTCTGAGTAAAACGGTATTTTATATAAG
ATCAATGAAGATAGCACTTAATAGATAAATATAGAAAAAGAAGCTAAAAATGAAACTCTT
AAAGAAGCGTTTGAAGAAGCAGTAACAGAGAAAATCTAAGAATAGCTTAACAATTTAGAA
TAGTTTATAAATGATTTTTAACAAAATAATTTTATCTCTTAATCTTAAATTTTAGAGGAA
TCACACAAAGAAAATCAAATTTCTCACAGTAATAATTAGAATTAATAAAAGGCAGAGATA
AAGAACTAAGATGAAAATGAAAACCTCAAGAACGAACAAAAAAATAGTTTGAAAAATCAA
TTAAATTCGTTAGACAAATAAATAAATTTTATAATAGATTAAAATTAAACCAAAGAAATA
AACCAAGTCAAATTAAATTACATTAATAAACACGCATACACTTTTGAAGATGAAGTTTAT
ATTATACAAAATAGATTATTTCTCTTGGAGACATTAAATTACTTCTAAATAATGGAGGAG
TCTTCAAATGAAGAAAAATTAATTTAGTTAAAAAATATAGAGTTAGAAAAAATAATTAAC
CTCCTTATCATACGCTACTAATAGCAGTATGAGCAAAACAATAAAGAGTTCGAAAATTTA
AAACTTAGAATTAAAGAAGACTTTGAGCAAGAGAGAAGAATTAATGATGTATAAAGCTTA
GATTTTAATGATATATTAATAGATTTAAACACAATGAACCCTATAGAAAAAGAATATATA
AAATTCTTAGAGTCAAAATAATAATTGGATTACAGCTAATCAATCTAAATAATGCAACAA
CAGTAAAATATTTTAGGAGATTTACCAGATTAGGCTATTGTAGGGTAGCAATCCTTAAAA
TCTTAGGGTTCAACAAAGTAAGTTTTAATTAAACATAGTGAAGAAACTAGATGCCAAGTT
TGTAATGAGTGTGATTATGCTGATAATGATCTGATCGTTTTTTGTTCAGTAAATTTTTTT
TAATTTTTAATATTTTTAAATATTTTTTTACTATAATTGCAGAGGTGCAACATGTCAGTG
CATTAAAAGTGCTATGGTATTGCTTCTCTACCATAAGAAGATTGGATATGCGACGCATGC
ATATCCTTTGGACCTAATGCAAAGTATTTAAGATGTGCACTTTGTACTAAAAGAGGAGGA
GCTCTTAAAAGGTCAAAAATGCCTGTAAAAACAAACTTTTTTGAGCATCTTAATACAGAT
TATCACTCCTATTTAAAAAATCTCCCTGAAGAATTCAGCGATTAACCTGAAGTTTACGGT
AATTATTTTCCATAAAATTATAATATATTCAATATATAAATAATTATAGACACATCACTT
TGGGAAAATGATAAGAAGAGAAGTACTAACAAATCTCCTCAAAATGATGAAAATTAAGAA
GAAACAGAACTCTATTTTGATTTTTAGTATTAAAATAAGGTATATCCACCTGAGGAAATT
CAAAAATATGAGCCAAAATCAAAGAATATTTGGATCCACCTCACTTGTGCTTTGTGGATA
TAAGAATGCTATTTTGAAGAGAGATCCTCACTAAATATGATTAGAGGTAAATTTTTTGAT
TATTTTAAGAATAATATTTTGATATTTTTTATAAACATATTAAAATTTTAAATAATTTAA
TTTAATAGGAATAGAAAATATAGATAAGAAGAGATTCTTGTTAACTTGTTTGATTTGTAA
GCAGAAAAGTAATAAATATTTTTTGATAATAAATGGCATTATATTGAATTTATTTTTAAT
TGAATTTGAAGAAAGTGGCTGCTGCATTTAGTGTGCAAAAGGTAAATGCTCTGCTTCTTT
CCATCCGGAATGTGCTAGGAGAGCAGGACTTTCGCTTGAAGTACGACATCTTGAAAAAGT
CACTCACTTGGTGTTTTGTTAAAGACATACTCCTTTAAAATTGAGAAGAATTCTTGAACA
GAAAGAGAAAAAATATAAAGATGAGATTCAAAAATTCTGCAGATCTATTGAAAAATACAA
TGAAACTTATTTCAATGAATATAAAGCCAAAGAAAAATAGAAGGCATTTAAGCCTTCTAA
AACCCTGCTTAAAAAAGCACTTAAAGATTAAGAAAGAGAAGAAAAAGAATTTATGAAAGT
AAGTTTAATATAGAATTTTATAAAAATAAATATTTTTATGAAAAATAGCAATTTAGCCTT
TATCTTCTGGAAACACCATAAAATAATTTTGTAATAAACCTCTCTAAAGAATATGATGAC
TTTGAAGAATCTATAATAGCCTATCATGTTGTAGATATTAACAGACCAAAATAATAGCAT
TTAAGAACTTAGATTTCTAAAAATGACGATATTTGGAAAACAATAGAATTTAATGAATAT
CCTCCAATCCATTTGTTTAAATTATATAAAAAGCTCATAAAATCAAAAAAAGTAGAATTT
AAAAATATATTTAATAGCCTAAAGAGAATCAAAGATAAAGAGCAAGAAGAACTTTTTATT
AAGCAATAAAAATAAATGAAAAAAGAATAGTAAATGCTGAAAAAGGAGATGCTTCGTTAA
GAAAAAGAAAAGAAGAAAATGCTTTAAAAGCAGAAACAATTAGAAGGTTTGAATCCTCGT
AAAATTTTGCACACAGAGAATGATAACATAGAATCTAGCTAAATAAACTAAACAAATGAG
TTATCCTTTCTTGATGACGAAACATCAAAAATGTAGCTATCATAATCGATTTAATAAATC
CAAAGAGCAATTTAACCAAAAAGAAAATATAATAAGTAAAAAAAGAATAATATTTTAGAA
AACAATGCAAGCAGCAATGAAAATGGGTATTCTTACATTCAAAATGAAAGCAATGTTAAT
TAATCTTAAAATGGAGACTTAAGATTTAATCAGCAATCTCATCTAAATGCTGATACAAGT
AACTATAACTAAGAAATAGAAAATTCAAATGCTTTTCCTGATATTGTAAGTGCCTCAAGT
GATTTTCCATTAAAATCTAAATCAAAAGATAAGAAATCCTAAAAAATTAAAGAAAAGCAA
AATGAAAAACATATAAAAAATTATAAAAATATTGATTCACAGCAAAGCTTGGATAAATAA
AAGAATCTCAAAAAGAAATTAAATAAGCATAGATCGAAAGGTAACAAACAGCTTTATAAG
CAATTTTTTATTTAATTTTATTTAAATTGTATTTTAATATTTAAAATGATATTTTTTCAC
TTTTAAAATCAATAAAATGATTAAAAATTGAATTTATAATTTATTATATTTTAATTACAG
GTGAATATCAATTAAATTCCTAAGGTGAAGAATAATTTGTCTTAAATAAAAGTGCTAAAT
CAGTGTAAGGTGAAGACGATGATGAAAAGCTTTACTGTTATTGCCAAAAGCCCTATAATG
AAGGTGAATTCATGATATGTAAAAGATTAATGTTTATTTTAAAATTTAATTTAACCAAAA
CAAAATTTTTTATTTTAGAATGCTAAAATTGTGAAGAGTGGTTTCATTTTGAATGTATTG
GGTATATTGGAACTGATACAGAGGCTGAAGATATTGATTTTTTTTGTAATGAATGTGATG
TAGATGGTAAATTATTTTAGAGTAAAGAAGAATATGAGCGCTTCTTTGATCCTTAGCAAG
CTCTCTACTCTACCTACAAGCAGCTAAAAAATAAAATCACAACTCCATCTTTCAGGTAAA
AGCTTATCTTGGAACGTAAAGACTTAGCTTCTGCAAATAGTATTCATAGTAGTACTAACT
TAAAAAGCGAAAAGAAGAAAGATAAAAAAACTACTAGTGGTTTATAAGAAAATGAATCTA
ATAGCTTAAGCAAGAGCAAGGCATCAAACACAGCAAATAGCTCATAAGATTTGGCAAATA
AAAAATTACAAAGTAATGAATAGGCTCTTTTATCGTAGCTTATTTAAATAAGTGAAAACT
AAATGAAAAAGCAATAAGAAAAATCTAATGGTGTAATGGAGGTTGAGCTTGTCAACCAAT
AAATTCCCAAAAATAACCATAATGATTAAGATAAAGAACTTTATGAAGAATTATAAGAGA
GTTTTAGTGATATTATGAATTCTAGTTAAGAAGAAAATAATAGAATAGAAAAAACTATTT
CAATAGAAAAAGAAGATAATGAGGAGGAAAGTTTAGAATTATTATATGAAGAATTCACTG
ATTCATATATTAAATAAAATAACATTATATTAGAAGAAGTTAGTACGATTATTAAATTAA
GAAAATTAGAAGATGGAAGCATAATTCTGGTAGAAGATTAGAATATATAACCTTAAGAAT
GA