Identifiers and Description

Gene Model Identifier

TTHERM_00715720

Standard Name

AAG1 (homolog of AlkylAdenine DNA Glycosylase 1)

Aliases

PreTt19046 | 113.m00085 | 3673.m00009

Description

3-methyladenine DNA glycosylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00567 ) DNA-3-methyladenine glycosylase
  • ( PF02245 ) Methylpurine-DNA glycosylase (MPG)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00715720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16844.11.9996161777617176e-164DNA-3-methyladenine glycosylas
e (241 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00715720(coding)
ATGTAAAAACAAAAAAGGCCACAAGAAGATATTGAACAGCCAAAGCAAAAATCTATATCA
GATTTTTTTGGAAAAAAGGCTAGCGCAAAGAAGGCTGATGATGATTAACTAAAATAAGTA
CCAGATAGCTTTTATGAAAAAGATGTTGTGACATTAGCATAAGATTTACTAGGAAAGCTG
ATTGTTCATAAAACAAAAGATGGGATAATTGCATGCAGGATAGTAGAAACTGAGGCTTAT
AAGGCTCCAGAAGATAAGGCGTGTCATGCGTATAAAAATAAAAAAACTGAAAAGACAAGC
TCATTTTGGCTTCCAGGAGGTCATGTATATATGTTTACAATTTATAATAATACTTGGTGC
TTTAATGTTGTTGCAGCCACAGCTGAAGAACCAGAAGCTGTTCTTGTTAGAGCTGTAGAG
CCAATTAAAGGACTCCATTTAATTCATAGAAATAGATCCTCACTGAAATCAAATAAAACC
GAAGATTTAGTTAATGGACCTGGAAAACTTACATTGGCTATGGGCATCACCAAAGAAAGA
AATGGATTTGATATGAGAGGAGAAGGAAAAGATTTATTTATAGCAGAATCACCTGAAAAT
TTAAAAAAGTTTGAAATAATTGCAAGCAAAAGAATAAATATAGATTATGCAGAAGAGTGG
ATAGATAAATATTGGAGGTTTACAATCAAAGATAATAAATTTGTTAGTGTTCCCTTGTAA
TTTTGA


>TTHERM_00715720(protein)
MQKQKRPQEDIEQPKQKSISDFFGKKASAKKADDDQLKQVPDSFYEKDVVTLAQDLLGKL
IVHKTKDGIIACRIVETEAYKAPEDKACHAYKNKKTEKTSSFWLPGGHVYMFTIYNNTWC
FNVVAATAEEPEAVLVRAVEPIKGLHLIHRNRSSLKSNKTEDLVNGPGKLTLAMGITKER
NGFDMRGEGKDLFIAESPENLKKFEIIASKRINIDYAEEWIDKYWRFTIKDNKFVSVPLQ
F


>TTHERM_00715720(gene)
ATGTAAAAACAAAAAAGGCCACAAGAAGATATTGAACAGCCAAAGCAAAAATCTATATCA
GATTTTTTTGGAAAAAAGGCTAGCGCAAAGAAGGCTGATGATGATTAACTAAAATAAGTA
CCAGATAGCTTTTATGAAAAAGATGTTGTGACATTAGCATAAGATTTACTAGGAAAGCTG
ATTGTTCATAAAACAAAAGATGGGATAATTGCATGCAGGATAGTAGAAACTGAGGCTTAT
AAGGCTCCAGAAGATAAGGCGTGTCATGCGTATAAAAATAAAAAAACTGAAAAGACAAGC
TCATTTTGGCTTCCAGGAGGTCATGTATATATGTTTACAATTTATAATAATACTTGGTGC
TTTAATGTTGTTGCAGCCACAGCTGAAGAACCAGAAGCTGTTCTTGTTAGGTATTTATTT
AAAATTCTTTTAAAATTTATTATTAACTTATTTATTTTTTATGTAGAGCTGTAGAGCCAA
TTAAAGGACTCCATTTAATTCATAGAAATAGATCCTCACTGAAATCAAATAAAACCGAAG
ATTTAGTTAATGGACCTGGAAAACTTACATTGGCTATGGGCATCACCAAAGAAAGAAATG
GATTTGATATGAGAGGAGAAGGAAAAGATTTATTTATAGCAGAATCACCTGAAAATTTAA
AAAAGTTTGAAATAATTGCAAGCAAAAGAATAAATATAGATTATGCAGAAGAGTGGATAG
ATAAATATTGGAGGTTTACAATCAAAGATAATAAATTTGTTAGTGTTCCCTTGTAATTTT
GA