Identifiers and Description

Gene Model Identifier

TTHERM_00052310

Standard Name

AAC (ADP/ATP Carrier)

Aliases

PreTt11411 | 3.m01987 | 3824.m03166

Description

Hydrogenosomal ADP/ATP carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.5%

TetraMine Data

TTHERM_00052310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01536.19.997093137033517e-262ADP, ATP carrier protein 1 (31
0 aa)
SGDYBL030C8.000452576646126e-141PET9 Major ADP/ATP carrier of
the mitochondrial inner membra
ne, exchanges cytosolic ADP fo
r mitochondrially synthesized
ATP; also imports heme and ATP
; phosphorylated; required for
viability in many lab strains
that carry a sal1 mutation
OxytrichaContig10229.0.g323.000935899181433e-99Mitochondrial carrier protein
WormBaseWBGene000064392.9996277075259347e-88locus:ant-1.1 status:Confirm
ed UniProt:O45865 protein_
id:CAB04874.1
DictyBaseDDB_G02674542.0008312485874125e-83ancA on chromosome: 1 position
424007 to 425518
Stentor CoeruleusSteCoe_124418.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00052310(coding)
ATGTCTCAAAAGAAGCAAACTACTCCCTTAGATTTCATCAAGGATTTCTTGACTGGTGGT
GTCTCCGCCTCCATTTCCAAGACTATCGCTTCCCCCATCGAAGTCATCAAGATGAGAGTT
TAAAATCAAGATGAAATGATCAAGCAAGGTGCCTTGGACAAGAGATACAACGGTATTGTT
GACTGTTCCAAGAGAATCCTCAATGAAGAAGGTGCTAAGGCTTTCTGGAAGGGTAACTGG
ACTAACGTCTTAAGATATTTCCCCACTCAAGCCTTGAACTTCGCCTTCAAGGATACCTTC
AAGAGAATGTTCAATAAAAAGAAAGAAGACGGTTATGCTATCTGGTTCGCTGCTAACATG
GCTTCCGGTGGTTTAGCTGGTTCCGTCTCTCTCGCTTTCGTCTACTCTTTGGACTACGCC
AGAACTAAGTTAACCAACGATTTAAAATCCTCCAAGAAAGGTGGTCAAAAGTAATACAGC
GGTTTAGTTGATGTTTATAAGAAAACTCTTGCTACCGACGGTGTTGCTGGTCTCTACAGA
GGTTTCGTTATTTCTTGCGTTGGTATTGTTATTTACAGAGGTCTTTACTTCGGTCTCTAC
GATACCGTCAAGCCCTTACTCCCCAGTAACATTAAGAACAACTTCTACGTTAACTTCGGT
GTTGGTTGGACCGTTACCGTCCTCGCCGGTTTGGCCTCTTACCCCATCGATACCATCAGA
AGAAGAATGATGATGACCTCCGGTCAAGCCGTCAAGTACAACGGTTCTATTGACTGTTTC
TAACAAATTGTTGCCAAGGAAGGTGCCCTCTCCTTATTCAAGGGTGCTGGTGCTAACATT
CTTAGAGGTGTTGCTGGTGCTGGTGCTATCTCTGGTTACGACTGGATCCAAAGAAAGATC
GACCCCAATGCCAAGCCCTCTTCTGAGTGA


>TTHERM_00052310(protein)
MSQKKQTTPLDFIKDFLTGGVSASISKTIASPIEVIKMRVQNQDEMIKQGALDKRYNGIV
DCSKRILNEEGAKAFWKGNWTNVLRYFPTQALNFAFKDTFKRMFNKKKEDGYAIWFAANM
ASGGLAGSVSLAFVYSLDYARTKLTNDLKSSKKGGQKQYSGLVDVYKKTLATDGVAGLYR
GFVISCVGIVIYRGLYFGLYDTVKPLLPSNIKNNFYVNFGVGWTVTVLAGLASYPIDTIR
RRMMMTSGQAVKYNGSIDCFQQIVAKEGALSLFKGAGANILRGVAGAGAISGYDWIQRKI
DPNAKPSSE


>TTHERM_00052310(gene)
ATGTCTCAAAAGAAGCAAACTACTCCCTTAGATTTCATCAAGGATTTCTTGACTGGTGGT
GTCTCCGCCTCCATTTCCAAGACTATCGCTTCCCCCATCGAAGTCATCAAGATGAGAGTT
TAAAATCAAGATGAAATGATCAAGCAAGGTGCCTTGGACAAGAGATACAACGGTATTGTT
GACTGTTCCAAGAGAATCCTCAATGAAGAAGGTGCTAAGGCTTTCTGGAAGGGTAACTGG
ACTAACGTCTTAAGATATTTCCCCACTCAAGCCTTGAACTTCGCCTTCAAGGATACCTTC
AAGAGAATGTTCAATAAAAAGAAAGAAGACGGTTATGCTATCTGGTTCGCTGCTAACATG
GCTTCCGGTGGTTTAGCTGGTTCCGTCTCTCTCGCTTTCGTCTACTCTTTGGACTACGCC
AGAACTAAGTTAACCAACGATTTAAAATCCTCCAAGAAAGGTGGTCAAAAGTAATACAGC
GGTTTAGTTGATGTTTATAAGAAAACTCTTGCTACCGACGGTGTTGCTGGTCTCTACAGA
GGTTTCGTTATTTCTTGCGTTGGTATTGTTATTTACAGAGGTCTTTACTTCGGTCTCTAC
GATACCGTCAAGCCCTTACTCCCCAGTAACATTAAGAACAACTTCTACGTTAACTTCGGT
GTTGGTTGGACCGTTACCGTCCTCGCCGGTTTGGCCTCTTACCCCATCGATACCATCAGA
AGAAGAATGATGATGACCTCCGGTCAAGCCGTCAAGTACAACGGTTCTATTGACTGTTTC
TAACAAATTGTTGCCAAGGAAGGTGCCCTCTCCTTATTCAAGGGTGCTGGTGCTAACATT
CTTAGAGGTGTTGCTGGTGCTGGTGCTATCTCTGGTTACGACTGGATCCAAAGAAAGATC
GACCCCAATGCCAAGCCCTCTTCTGAGTGA